SimulationCraft 1100-02

for World of Warcraft 11.0.7.58911 Live (hotfix 2025-02-03/58911, git build d2465f0)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Combo 1 : 628,903 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
628,903.1628,903.11,231.7 / 0.196%87,084.3 / 13.8%21,136.9
Resource Out In Waiting APM Active
Energy29.729.512.24%56.9100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 1628,903
Auto Attack 0 (36,865)0.0% (5.9%)3.9122.41s2,815,2480

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 24,5043.9%349.31.00s20,97521,188Direct349.320,75541,76120,97517.3%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage349.28349.280.000.000.000.99000.00007,326,309.319,562,422.5923.38%21,188.1421,188.14
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.34%231.7316130620,754.8512,41733,10420,763.3119,69521,8304,809,4936,278,05323.39%
crit17.26%60.27359741,760.5524,83466,20841,794.8736,73146,8922,516,8173,284,36923.37%
miss16.40%57.2831860.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 12,3612.0%348.91.00s10,59410,664Direct348.910,47721,11810,59517.2%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage348.86348.860.000.000.000.99350.00003,695,993.194,824,068.6623.38%10,664.3410,664.34
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.39%231.6016830910,476.536,26416,67410,481.0510,03211,1552,426,3923,167,24223.39%
crit17.23%60.12329621,118.2512,65333,34821,128.0018,90924,1721,269,6011,656,82723.37%
miss16.38%57.1430860.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 15,9672.5%74.63.73s64,16163,873Direct74.639,449102,38264,15139.3%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.5874.580.000.000.001.00450.00004,785,011.296,265,253.9523.63%63,873.3963,873.39
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.74%45.30287239,448.5331,15376,98939,452.6536,86741,7831,786,9632,340,79323.65%
crit39.26%29.281251102,382.4868,537208,707102,382.7193,332113,7522,998,0483,924,46123.62%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:74.58

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 40,048 (57,115)6.4% (9.1%)13.222.32s1,295,2551,075,363Direct39.5 (77.4)239,397474,455303,37527.2% (27.0%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.1839.490.000.000.001.20450.000011,972,413.9315,588,780.7323.20%1,075,363.461,075,363.46
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.80%28.751742239,396.8654,359892,494239,521.30147,145324,0566,879,5848,957,85723.20%
crit27.20%10.74220474,454.95108,7181,779,124475,898.06121,7411,016,8485,092,8306,630,92423.21%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.18
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 17,0672.7%0.00.00s00Direct37.9106,266212,167134,68926.8%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0037.900.000.000.000.00000.00005,102,207.145,102,207.140.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.17%27.731543106,265.8924,765387,196106,417.3269,425145,5362,944,6642,944,6640.00%
crit26.83%10.17222212,167.3551,831771,847212,665.4799,703422,8352,157,5432,157,5430.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Eviscerate 115,919 (165,917)18.4% (26.4%)68.04.40s728,964725,704Direct68.0 (134.5)397,137815,371509,34326.8% (26.9%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.9967.990.000.000.001.00450.000034,626,784.1145,045,450.3223.13%725,704.17725,704.17
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.17%49.743269397,137.3895,7241,100,312397,143.32329,463471,66919,748,30025,692,64023.14%
crit26.83%18.24832815,371.15191,4472,267,171816,269.09524,1821,150,30814,878,48419,352,81023.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:67.99

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 49,9987.9%66.54.51s224,3940Direct66.5174,900357,987224,40827.1%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.5566.550.000.000.000.00000.000014,932,279.3114,932,279.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.94%48.543167174,899.9445,636491,790174,918.68145,281210,3118,487,0498,487,0490.00%
crit27.06%18.01633357,986.8991,271934,850358,393.72238,027523,1426,445,2316,445,2310.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 556 (11,184)0.1% (1.8%)3.791.39s902,338898,469Direct3.7 (27.5)37,86875,49444,80818.4% (17.9%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000166,076.38166,076.380.00%898,469.36898,469.36
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.60%3.020437,868.2933,21773,22737,690.79056,804114,560114,5600.00%
crit18.40%0.680475,493.7266,435144,19239,861.500138,54351,51651,5160.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.71
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 10,6271.7%0.00.00s00Direct23.8113,248225,972133,38117.9%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.830.000.000.000.00000.00003,178,925.053,178,925.050.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.13%19.581027113,248.4543,408235,759113,162.8893,449134,8242,216,5822,216,5820.00%
crit17.87%4.26012225,972.3584,693471,518222,882.850417,670962,343962,3430.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 6,4131.0%0.00.00s00Direct279.45,84111,7466,86317.3%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00279.430.000.000.000.00000.00001,917,700.381,917,700.380.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.69%231.061633315,840.834,0979,0365,842.555,5256,2021,349,5101,349,5100.00%
crit17.31%48.37228611,746.358,19418,07211,750.1510,34513,641568,190568,1900.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 43,911 (51,981)7.0% (8.3%)9.531.39s1,634,3111,627,115Periodic164.7 (329.4)62,104129,34179,70226.2% (26.2%)0.0%97.0%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.510.00164.71164.716.991.00451.763113,126,393.0013,126,393.000.00%51,805.301,627,115.07
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.82%121.598516062,104.4053192,50362,141.5954,35572,7547,551,6497,551,6490.00%
crit26.18%43.122272129,341.17453376,998129,542.5087,913178,0985,574,7445,574,7440.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.51
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 8,0701.3%164.71.79s14,6480Periodic164.711,42323,73314,64926.2%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage164.710.000.00164.710.000.00000.00002,412,555.962,412,555.960.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.80%121.558815711,423.324,39035,29811,430.7210,09712,7841,388,4411,388,4410.00%
crit26.20%43.15226723,733.438,78069,03823,766.7017,34832,0811,024,1151,024,1150.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (124,956)0.0% (19.9%)15.918.97s2,343,2352,332,762

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.940.000.000.000.001.00450.00000.000.000.00%2,332,762.352,332,762.35

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.94
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 32,1065.1%0.00.00s00Direct15.9312,3331,002,110602,40042.0%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.940.000.000.000.00000.00009,597,132.7312,512,911.6723.30%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.97%9.24415312,332.8468,374757,739312,757.53204,986430,5792,885,7413,773,61923.53%
crit42.03%6.703131,002,110.43137,7761,843,7021,023,104.92671,3691,538,5176,711,3928,739,29323.20%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 92,85014.8%0.00.00s00Direct31.8454,4601,439,054873,45442.6%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.780.000.000.000.00000.000027,752,725.3127,752,725.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.42%18.25829454,460.39100,6071,095,781454,873.59338,279583,2548,289,1658,289,1650.00%
crit42.58%13.536231,439,053.76211,2762,666,2131,454,255.76963,1892,095,80419,463,56119,463,5610.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (50,405)0.0% (8.0%)3.790.91s4,126,6930

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 50,4058.0%382.41.21s39,4130Periodic382.439,407039,4070.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage382.360.000.00382.360.000.00000.000015,069,772.0515,069,772.050.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%382.3627946539,407.4027514,19439,447.3633,52646,52615,069,77215,069,7720.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2406.04
  • base_dd_max:2406.04
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 63,01210.0%52.35.79s359,673358,063Direct52.3152,000495,668359,74760.4%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2652.260.000.000.001.00450.000018,797,215.9424,516,815.7823.33%358,062.67358,062.67
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit39.57%20.68932151,999.8171,021215,170151,981.64134,746170,7213,142,8014,094,39623.25%
crit60.43%31.581843495,668.19156,245726,199496,126.08459,766533,59715,654,41520,422,42023.35%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Unseen Blade 45,0897.2%57.85.13s233,4220Direct57.8198,674400,155233,45617.3%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.7657.760.000.000.000.00000.000013,483,150.1817,620,476.1223.48%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.74%47.792966198,673.51120,399291,818198,736.48182,567214,8429,494,45312,408,54923.48%
crit17.26%9.97222400,154.96240,799583,635400,685.98299,319519,3663,988,6985,211,92723.48%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 1
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.74s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.560.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.60s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.720.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5307.19s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.47
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.63.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.223.17s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.24
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 14.221.34s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.25
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.41s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.92
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1582.6167.8s0.5s274.2s99.94%100.00%572.8 (572.8)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.2s / 356.0s
  • trigger_min/max:0.0s / 4.2s
  • trigger_pct:100.00%
  • duration_min/max:2.1s / 359.9s
  • uptime_min/max:99.13% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.16%
  • acrobatic_strikes_8:0.16%
  • acrobatic_strikes_9:0.16%
  • acrobatic_strikes_10:98.30%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.381.9118.2s3.5s125.4s97.33%0.00%73.4 (76.2)1.3

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 333.7s
  • trigger_min/max:1.0s / 46.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.9s
  • uptime_min/max:87.19% / 99.44%

Stack Uptimes

  • alacrity_1:3.14%
  • alacrity_2:2.27%
  • alacrity_3:1.88%
  • alacrity_4:1.65%
  • alacrity_5:88.39%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.55%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.55%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows15.90.019.0s19.0s6.9s36.91%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 55.5s
  • trigger_min/max:9.2s / 55.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.49% / 39.83%

Stack Uptimes

  • bolstering_shadows_1:36.91%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.2s0.00%1.42%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.1s / 99.7s
  • trigger_min/max:83.1s / 99.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 0.2s
  • uptime_min/max:0.00% / 0.09%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0133.7s112.0s4.4s1.86%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.6s
  • trigger_min/max:90.0s / 251.4s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 11.9s
  • uptime_min/max:0.00% / 7.24%

Stack Uptimes

  • cryptic_instructions_1:1.86%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.247.723.2s23.2s8.2s36.40%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 71.1s
  • trigger_min/max:8.0s / 71.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.48% / 39.38%

Stack Uptimes

  • danse_macabre_1:0.03%
  • danse_macabre_2:4.53%
  • danse_macabre_3:6.64%
  • danse_macabre_4:16.49%
  • danse_macabre_5:8.69%
  • danse_macabre_6:0.02%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.673.640.9s3.7s35.6s89.88%95.60%73.6 (73.6)6.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 174.1s
  • trigger_min/max:1.0s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 159.4s
  • uptime_min/max:81.10% / 96.31%

Stack Uptimes

  • deeper_daggers_1:89.88%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes15.90.019.0s19.0s3.4s18.33%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 55.5s
  • trigger_min/max:9.2s / 55.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.03% / 21.51%

Stack Uptimes

  • disorienting_strikes_1:12.18%
  • disorienting_strikes_2:6.15%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0130.8s115.5s4.0s1.62%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 298.6s
  • trigger_min/max:90.0s / 188.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.1s
  • uptime_min/max:0.00% / 7.42%

Stack Uptimes

  • errant_manaforge_emission_1:1.62%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.043.822.2s5.2s17.4s81.50%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 60.7s
  • trigger_min/max:1.0s / 24.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.1s
  • uptime_min/max:65.02% / 92.11%

Stack Uptimes

  • escalating_blade_1:24.66%
  • escalating_blade_2:22.05%
  • escalating_blade_3:22.64%
  • escalating_blade_4:12.14%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.8s18.24%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:9013.45

Trigger Details

  • interval_min/max:82.4s / 183.9s
  • trigger_min/max:82.4s / 183.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:12.91% / 20.79%

Stack Uptimes

  • ethereal_powerlink_1:18.24%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.9s14.70%0.00%14.2 (96.1)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.0s
  • trigger_min/max:1.0s / 87.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.94% / 16.94%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.61%
  • flagellation_buff_10:0.55%
  • flagellation_buff_11:0.48%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.44%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.32%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.18%
  • flagellation_buff_25:0.85%
  • flagellation_buff_26:0.39%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.11%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.27%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.1s / 98.0s
  • trigger_min/max:78.1s / 98.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s
  • uptime_min/max:12.42% / 16.24%

Stack Uptimes

  • flagellation_persist_11:0.00%
  • flagellation_persist_23:0.01%
  • flagellation_persist_26:0.01%
  • flagellation_persist_30:14.26%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6115.0s77.1s35.4s24.23%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.6s / 344.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 67.23%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.23%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.7112.6s76.4s35.7s25.63%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.9s / 343.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 75.69%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.63%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.7113.7s75.8s35.9s25.11%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 345.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 210.0s
  • uptime_min/max:0.00% / 74.45%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.11%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.1s75.6s35.2s25.04%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:32.4s / 336.6s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 239.2s
  • uptime_min/max:0.00% / 90.82%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.04%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form86.90.039.6s3.4s59.5s95.35%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.72%
  • flawless_form_2:8.79%
  • flawless_form_3:11.84%
  • flawless_form_4:9.83%
  • flawless_form_5:2.73%
  • flawless_form_6:4.55%
  • flawless_form_7:5.86%
  • flawless_form_8:11.36%
  • flawless_form_9:18.43%
  • flawless_form_10:8.55%
  • flawless_form_11:1.36%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.16%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.283.7s70.0s17.0s10.73%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:3.0s / 305.0s
  • trigger_min/max:0.3s / 305.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 50.7s
  • uptime_min/max:0.00% / 39.04%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.73%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.0s73.6s16.6s10.76%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.3s / 325.5s
  • trigger_min/max:0.3s / 325.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 53.0s
  • uptime_min/max:0.00% / 45.16%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.76%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)2.00.283.6s69.4s17.0s11.18%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.9s / 323.7s
  • trigger_min/max:0.1s / 323.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:0.00% / 36.08%

Stack Uptimes

  • nascent_empowerment_Mastery_1:11.18%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)2.00.284.6s71.8s16.9s11.07%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.0s / 278.3s
  • trigger_min/max:0.1s / 278.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 58.4s
  • uptime_min/max:0.00% / 39.60%

Stack Uptimes

  • nascent_empowerment_Vers_1:11.08%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.7s17.00%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.5s
  • trigger_min/max:1.0s / 63.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:9.15% / 26.60%

Stack Uptimes

  • poised_shadows_1:17.00%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.56%11.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 64.8s
  • trigger_min/max:1.0s / 64.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.39% / 4.98%

Stack Uptimes

  • premeditation_1:2.56%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0135.3s113.1s4.0s1.65%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.3s
  • trigger_min/max:90.0s / 191.5s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 10.9s
  • uptime_min/max:0.00% / 7.08%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.65%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow Blades3.70.090.9s90.9s15.8s19.28%17.34%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.2s
  • trigger_min/max:90.0s / 98.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.70% / 21.86%

Stack Uptimes

  • shadow_blades_1:19.28%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.20.023.2s23.2s8.2s36.40%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 71.1s
  • trigger_min/max:8.0s / 71.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.48% / 39.38%

Stack Uptimes

  • shadow_dance_1:36.40%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques67.5136.14.4s1.5s3.5s79.12%95.45%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 41.4s
  • trigger_min/max:0.5s / 6.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.4s
  • uptime_min/max:71.05% / 87.51%

Stack Uptimes

  • shadow_techniques_1:20.55%
  • shadow_techniques_2:21.01%
  • shadow_techniques_3:9.32%
  • shadow_techniques_4:10.57%
  • shadow_techniques_5:5.97%
  • shadow_techniques_6:5.83%
  • shadow_techniques_7:2.52%
  • shadow_techniques_8:2.33%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.02%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.2s99.32%85.78%98.6 (98.6)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.30.0118.9s105.6s9.9s1.13%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.2s / 318.9s
  • trigger_min/max:1.2s / 318.9s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 16.2s
  • uptime_min/max:0.00% / 11.84%

Stack Uptimes

  • storm_sewers_citrine_1:1.13%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s11.06%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 63.8s
  • trigger_min/max:3.0s / 63.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.3s
  • uptime_min/max:9.18% / 14.16%

Stack Uptimes

  • supercharge_1_1:11.06%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.04%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 63.8s
  • trigger_min/max:1.0s / 63.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.3s
  • uptime_min/max:0.65% / 5.68%

Stack Uptimes

  • supercharge_2_1:2.04%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.2s
  • uptime_min/max:0.00% / 0.77%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.0s
  • uptime_min/max:0.00% / 0.35%

Stack Uptimes

  • supercharge_4_1:0.00%

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.843.5s21.3s24.6s61.16%100.00%6.8 (6.8)6.8

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.3s / 96.3s
  • trigger_min/max:1.0s / 63.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:58.01% / 65.11%

Stack Uptimes

  • symbols_of_death_1:61.16%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.6s307.6s27.5s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.0s
  • trigger_min/max:300.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.95% / 18.09%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.82%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.73%22.40%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 63.8s
  • trigger_min/max:1.0s / 63.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.6s
  • uptime_min/max:11.17% / 17.19%

Stack Uptimes

  • the_rotten_1:10.69%
  • the_rotten_2:3.03%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.3s122.3s0.1s0.09%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.3s
  • trigger_min/max:120.0s / 136.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.42%

Stack Uptimes

  • vanish_1:0.09%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)48.622.076.06.1s0.7s71.6s
Skyfury (Off Hand)48.626.079.06.0s0.7s70.6s
Supercharger secret_technique12.48.016.023.6s9.2s97.0s
Cold Blood secret_technique3.63.04.090.7s83.1s99.7s
Supercharger rupture0.30.02.0170.2s23.5s299.5s
Supercharger coup_de_grace2.70.07.075.9s9.2s301.2s
Supercharger eviscerate13.06.021.023.0s1.0s135.3s
CP Spent During Flagellation202.0143.0252.011.2s1.0s90.7s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.06%5.35%13.58%0.7s0.0s2.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 1
Energy RegenEnergy1,411.063,004.8934.01%2.13380.5611.24%
Improved AmbushCombo Points52.2533.314.59%0.6418.9536.26%
PremeditationCombo Points17.1456.667.80%3.3163.3152.77%
Relentless StrikesEnergy106.614,249.1048.09%39.86117.172.68%
Shadow BladesCombo Points22.02114.3315.75%5.1917.7713.45%
Shadow TechniquesEnergy354.621,221.8313.83%3.45196.6713.86%
Shadow TechniquesCombo Points84.73237.7832.75%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.05105.3314.51%7.000.000.00%
BackstabCombo Points74.5874.2110.22%1.000.370.50%
ShadowstrikeCombo Points52.25104.4714.39%2.000.030.03%
Symbols of DeathEnergy14.25360.754.08%25.32209.1236.70%
Usage Type Count Total Tot% Avg RPE APR
Combo 1
BackstabEnergy74.582,983.3233.55%40.0040.001,603.92
Coup de GraceEnergy13.18461.305.19%35.0034.9937,014.01
Coup de GraceCombo Points13.1890.0512.47%6.836.83189,616.86
EviscerateEnergy67.992,379.5826.76%35.0035.0020,826.81
EviscerateCombo Points67.99462.6964.07%6.816.81107,111.04
RuptureEnergy9.51237.682.67%25.0025.0065,378.11
RuptureCombo Points9.5165.049.01%6.846.84238,909.10
Secret TechniqueEnergy15.94478.135.38%30.0030.0078,116.20
Secret TechniqueCombo Points15.94104.3614.45%6.556.55357,891.50
ShadowstrikeEnergy52.252,351.3126.45%45.0044.997,994.36
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.5329.71903.345.20.1100.0
Combo Points0.02.432.41100.44.00.07.0

Statistics & Data Analysis

Fight Length
Combo 1 Fight Length
Count 1321
Mean 299.24
Minimum 240.10
Maximum 359.93
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Combo 1 Damage Per Second
Count 1321
Mean 628903.05
Minimum 569801.34
Maximum 706960.56
Spread ( max - min ) 137159.22
Range [ ( max - min ) / 2 * 100% ] 10.90%
Standard Deviation 22841.4699
5th Percentile 592247.40
95th Percentile 666000.70
( 95th Percentile - 5th Percentile ) 73753.30
Mean Distribution
Standard Deviation 628.4528
95.00% Confidence Interval ( 627671.31 - 630134.80 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5068
0.1 Scale Factor Error with Delta=300 4453811
0.05 Scale Factor Error with Delta=300 17815244
0.01 Scale Factor Error with Delta=300 445381082
Priority Target DPS
Combo 1 Priority Target Damage Per Second
Count 1321
Mean 628903.05
Minimum 569801.34
Maximum 706960.56
Spread ( max - min ) 137159.22
Range [ ( max - min ) / 2 * 100% ] 10.90%
Standard Deviation 22841.4699
5th Percentile 592247.40
95th Percentile 666000.70
( 95th Percentile - 5th Percentile ) 73753.30
Mean Distribution
Standard Deviation 628.4528
95.00% Confidence Interval ( 627671.31 - 630134.80 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5068
0.1 Scale Factor Error with Delta=300 4453811
0.05 Scale Factor Error with Delta=300 17815244
0.01 Scale Factor Error with Delta=300 445381082
DPS(e)
Combo 1 Damage Per Second (Effective)
Count 1321
Mean 628903.05
Minimum 569801.34
Maximum 706960.56
Spread ( max - min ) 137159.22
Range [ ( max - min ) / 2 * 100% ] 10.90%
Damage
Combo 1 Damage
Count 1321
Mean 187942645.27
Minimum 148900969.83
Maximum 226607561.44
Spread ( max - min ) 77706591.61
Range [ ( max - min ) / 2 * 100% ] 20.67%
DTPS
Combo 1 Damage Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 1 Healing Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 1 Healing Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 1 Heal
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 1 Healing Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.25 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 74.58 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.47 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.25 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.71 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.94 secret_technique,if=variable.secret
L 9.51 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.18 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 67.99 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.24 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.92 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNDMHNDFKNENNENEENEHQNDKDNDMDLENEENHQDNDKDNDNEENENEELHQDMDKDNDDNEENEENEEMEEOEJHQPKDNIDMDNNELEHQFKNDNDNNDNENEEEMRDNELEHEQKDNDMDNDNEENEEKEEELEEMEEENEENEOEJHQPKDNIDMDNNELHQDFKNDMDNNENENHQDKDMDNDNEENEELENEEHQKDNDMDNDNEENEKRDNEELEEEEEEOEJMHQPDKINNDNDNLHQDNDFKNDMDNNENEENEEHNQDKNDNDMGDLEENEEKEEEHMEQNDNDNDNDKE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, cryptic_instructions
0:01.006Gpotion
[cds]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, cryptic_instructions
0:01.006Jflagellation
[cds]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, cryptic_instructions, tempered_potion
0:02.011Neviscerate
[finish]
Fluffy_Pillow 86.1/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, cryptic_instructions, tempered_potion
0:03.016Rvanish
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:03.016Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(6), flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:04.021Lrupture
[finish]
Fluffy_Pillow 68.8/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:05.027Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(15), deeper_daggers, cryptic_instructions, tempered_potion
0:05.027Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, tempered_potion
0:05.027Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, tempered_potion
0:05.027Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.032Ishadow_blades
[cds]
Combo 1 84.8/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, flawless_form, shadow_techniques(6), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:06.032Ksecret_technique
[finish]
Fluffy_Pillow 84.8/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, flawless_form, shadow_techniques(6), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:07.037Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(8), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:08.040Neviscerate
[finish]
Fluffy_Pillow 68.9/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:09.043Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), disorienting_strikes, flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:10.049Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:11.054Neviscerate
[finish]
Fluffy_Pillow 69.2/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:12.058Dshadowstrike
[build]
Fluffy_Pillow 91.6/100 92% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:13.061Mcoup_de_grace
[finish]
Fluffy_Pillow 76.9/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(11), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:14.266Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:14.266Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:15.269Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:16.274Fcold_blood
[cds]
Combo 1 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:16.274Ksecret_technique
[finish]
Fluffy_Pillow 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:17.280Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:18.285Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:19.289Neviscerate
[finish]
Fluffy_Pillow 82.5/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:20.293Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:21.298Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:22.303Neviscerate
[finish]
Fluffy_Pillow 90.5/100 90% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:23.306Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, tempered_potion
0:24.311Ebackstab
[build]
Fluffy_Pillow 82.5/100 82% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery, tempered_potion
0:25.318Neviscerate
[finish]
Fluffy_Pillow 65.0/100 65% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.322Ebackstab
[build]
Fluffy_Pillow 87.5/100 87% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.328Hsymbols_of_death
[cds]
Combo 1 70.0/100 70% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.328Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.328Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.332Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.338Ksecret_technique
[finish]
Fluffy_Pillow 77.5/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:30.342Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
0:31.345Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:32.349Dshadowstrike
[build]
Fluffy_Pillow 91.2/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:33.354Mcoup_de_grace
[finish]
Fluffy_Pillow 68.1/100 68% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:34.559Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:35.565Lrupture
[finish]
Fluffy_Pillow 76.9/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:36.571Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_mastery
0:37.576Neviscerate
[finish]
Fluffy_Pillow 81.9/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:38.580Ebackstab
[build]
Fluffy_Pillow 95.9/100 96% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:39.583Ebackstab
[build]
Fluffy_Pillow 77.8/100 78% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:40.588Neviscerate
[finish]
Fluffy_Pillow 57.8/100 58% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:41.593Hsymbols_of_death
[cds]
Combo 1 71.5/100 72% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
0:41.593Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:41.593Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:42.598Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:43.602Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:44.608Ksecret_technique
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(6), shadow_techniques(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:45.613Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:46.616Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:47.620Dshadowstrike
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:48.623Neviscerate
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:49.628Ebackstab
[build]
Fluffy_Pillow 76.8/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:50.633Ebackstab
[build]
Fluffy_Pillow 55.5/100 56% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:51.802Neviscerate
[finish]
Fluffy_Pillow 44.0/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
0:52.808Ebackstab
[build]
Fluffy_Pillow 54.7/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
0:54.525Neviscerate
[finish]
Fluffy_Pillow 41.1/100 41% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:55.529Ebackstab
[build]
Fluffy_Pillow 54.8/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:57.255Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:59.120Lrupture
[finish]
Fluffy_Pillow 25.1/100 25% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:00.125Hsymbols_of_death
[cds]
Combo 1 45.8/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:00.125Qshadow_dance
[stealth_cds]
Combo 1 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:00.125Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:01.129Mcoup_de_grace
[finish]
Fluffy_Pillow 59.5/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:02.332Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:03.335Ksecret_technique
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:04.340Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:05.344Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:06.349Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:07.355Dshadowstrike
[build]
Fluffy_Pillow 58.2/100 58% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:09.288Neviscerate
[finish]
Fluffy_Pillow 41.8/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:10.292Ebackstab
[build]
Fluffy_Pillow 52.5/100 52% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:12.230Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:14.551Neviscerate
[finish]
Fluffy_Pillow 37.9/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:15.555Ebackstab
[build]
Fluffy_Pillow 48.6/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:17.841Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:20.778Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:21.782Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:24.068Ebackstab
[build]
Fluffy_Pillow 43.4/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
1:26.692Mcoup_de_grace
[finish]
Fluffy_Pillow 35.5/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
1:27.899Ebackstab
[build]
Fluffy_Pillow 77.5/100 77% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:28.904Ebackstab
[build]
Fluffy_Pillow 48.2/100 48% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:29.909Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 19.0/100 19% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:31.602Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:32.608Jflagellation
[cds]
Fluffy_Pillow 11.9/100 12% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:33.613Hsymbols_of_death
[cds]
Combo 1 30.7/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:33.613Qshadow_dance
[stealth_cds]
Combo 1 70.7/100 71% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:33.613Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 70.7/100 71% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:33.613Ksecret_technique
[finish]
Fluffy_Pillow 70.7/100 71% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:34.616Dshadowstrike
[build]
Fluffy_Pillow 96.4/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:35.621Neviscerate
[finish]
Fluffy_Pillow 70.2/100 70% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(4), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:36.626Ishadow_blades
[cds]
Combo 1 95.9/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:36.626Dshadowstrike
[build]
Fluffy_Pillow 95.9/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:37.630Mcoup_de_grace
[finish]
Fluffy_Pillow 69.7/100 70% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(6), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:38.835Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:39.841Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(10), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:40.846Neviscerate
[finish]
Fluffy_Pillow 92.5/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:41.850Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:42.856Lrupture
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:43.859Ebackstab
[build]
Fluffy_Pillow 99.5/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:44.863Hsymbols_of_death
[cds]
Combo 1 78.3/100 78% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:45.028Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(11), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:45.028Fcold_blood
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(11), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:45.028Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(11), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:46.031Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:47.036Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:48.041Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:49.044Dshadowstrike
[build]
Fluffy_Pillow 92.5/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:50.049Neviscerate
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:51.054Neviscerate
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:52.060Dshadowstrike
[build]
Fluffy_Pillow 95.8/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
1:53.065Neviscerate
[finish]
Fluffy_Pillow 61.6/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
1:54.069Ebackstab
[build]
Fluffy_Pillow 80.3/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
1:55.074Neviscerate
[finish]
Fluffy_Pillow 51.1/100 51% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
1:56.078Ebackstab
[build]
Fluffy_Pillow 61.9/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
1:57.081Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
1:59.670Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
2:02.645Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
2:03.849Rvanish
[stealth_cds]
Combo 1 74.1/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
2:03.849Dshadowstrike
[build]
Fluffy_Pillow 74.1/100 74% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), flawless_form(6), premeditation, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
2:04.854Neviscerate
[finish]
Fluffy_Pillow 43.9/100 44% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
2:05.859Ebackstab
[build]
Fluffy_Pillow 58.6/100 59% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
2:06.864Lrupture
[finish]
Fluffy_Pillow 29.4/100 29% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, flask_of_alchemical_chaos_mastery
2:07.870Ebackstab
[build]
Fluffy_Pillow 49.2/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:10.010Hsymbols_of_death
[cds]
Combo 1 36.1/100 36% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:10.028Ebackstab
[build]
Fluffy_Pillow 76.3/100 76% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:11.033Qshadow_dance
[stealth_cds]
Combo 1 55.1/100 55% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:11.033Ksecret_technique
[finish]
Fluffy_Pillow 55.1/100 55% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:12.038Dshadowstrike
[build]
Fluffy_Pillow 78.8/100 79% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:13.042Neviscerate
[finish]
Fluffy_Pillow 44.6/100 45% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(4), bolstering_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:14.048Dshadowstrike
[build]
Fluffy_Pillow 78.4/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:15.053Mcoup_de_grace
[finish]
Fluffy_Pillow 44.1/100 44% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:16.257Dshadowstrike
[build]
Fluffy_Pillow 90.0/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:17.261Neviscerate
[finish]
Fluffy_Pillow 63.8/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, storm_sewers_citrine
2:18.264Dshadowstrike
[build]
Fluffy_Pillow 82.5/100 83% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
2:19.269Neviscerate
[finish]
Fluffy_Pillow 56.3/100 56% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:20.275Ebackstab
[build]
Fluffy_Pillow 67.1/100 67% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:21.282Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:23.349Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:24.352Ebackstab
[build]
Fluffy_Pillow 46.0/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
2:27.113Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:29.341Ksecret_technique
[finish]
Fluffy_Pillow 30.3/100 30% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:30.345Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:33.148Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_haste
2:35.972Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(3), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_haste
2:37.966Lrupture
[finish]
Fluffy_Pillow 25.5/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(3), shadow_techniques(2), flask_of_alchemical_chaos_haste
2:38.969Ebackstab
[build]
Fluffy_Pillow 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form(3), shadow_techniques(2), flask_of_alchemical_chaos_haste
2:41.435Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(4), flawless_form(3), shadow_techniques(2), flask_of_alchemical_chaos_haste
2:44.192Mcoup_de_grace
[finish]
Fluffy_Pillow 35.1/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_haste
2:45.396Ebackstab
[build]
Fluffy_Pillow 72.2/100 72% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:46.400Ebackstab
[build]
Fluffy_Pillow 43.2/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(7), deeper_daggers, flask_of_alchemical_chaos_haste
2:49.124Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:51.586Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:52.591Ebackstab
[build]
Fluffy_Pillow 51.2/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
2:54.881Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:57.737Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:58.741Ebackstab
[build]
Fluffy_Pillow 46.3/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:01.113Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 36.8/100 37% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:01.525Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), escalating_blade, shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
3:02.529Jflagellation
[cds]
Fluffy_Pillow 12.6/100 13% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
3:03.613Hsymbols_of_death
[cds]
Combo 1 28.7/100 29% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
3:03.613Qshadow_dance
[stealth_cds]
Combo 1 68.7/100 69% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
3:03.613Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.7/100 69% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
3:03.613Ksecret_technique
[finish]
Fluffy_Pillow 68.7/100 69% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:04.616Dshadowstrike
[build]
Fluffy_Pillow 98.0/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:05.620Neviscerate
[finish]
Fluffy_Pillow 64.3/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:06.624Ishadow_blades
[cds]
Combo 1 98.7/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:06.626Dshadowstrike
[build]
Fluffy_Pillow 98.7/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:07.632Mcoup_de_grace
[finish]
Fluffy_Pillow 65.0/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:08.836Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:09.841Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:10.845Neviscerate
[finish]
Fluffy_Pillow 93.7/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:11.850Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:12.853Lrupture
[finish]
Fluffy_Pillow 79.3/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:13.856Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:13.856Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), shadow_techniques(8), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:13.856Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), premeditation, shadow_techniques(8), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:14.859Fcold_blood
[cds]
Combo 1 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(11), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:14.859Ksecret_technique
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade(3), flawless_form(11), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:15.863Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(11), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:16.867Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(10), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:17.870Mcoup_de_grace
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(11), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:19.075Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(15), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:20.079Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:21.084Neviscerate
[finish]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:22.089Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:23.094Neviscerate
[finish]
Fluffy_Pillow 79.3/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:24.097Ebackstab
[build]
Fluffy_Pillow 98.5/100 99% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:25.103Neviscerate
[finish]
Fluffy_Pillow 69.2/100 69% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:26.106Hsymbols_of_death
[cds]
Combo 1 87.9/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:26.106Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:26.106Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:27.109Ksecret_technique
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:28.112Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(10), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:29.117Mcoup_de_grace
[finish]
Fluffy_Pillow 81.7/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:30.322Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:31.326Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:32.331Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:33.336Neviscerate
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:34.341Ebackstab
[build]
Fluffy_Pillow 68.9/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:35.347Ebackstab
[build]
Fluffy_Pillow 47.6/100 48% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:37.306Neviscerate
[finish]
Fluffy_Pillow 36.5/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:38.310Ebackstab
[build]
Fluffy_Pillow 50.2/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:40.433Ebackstab
[build]
Fluffy_Pillow 48.8/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:41.438Lrupture
[finish]
Fluffy_Pillow 27.6/100 28% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:42.443Ebackstab
[build]
Fluffy_Pillow 56.3/100 56% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(7), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:44.296Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:45.301Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:47.398Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:49.846Hsymbols_of_death
[cds]
Combo 1 35.2/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:50.028Qshadow_dance
[stealth_cds]
Combo 1 77.2/100 77% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:50.028Ksecret_technique
[finish]
Fluffy_Pillow 77.2/100 77% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:51.032Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:52.037Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:53.042Dshadowstrike
[build]
Fluffy_Pillow 99.4/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:54.048Mcoup_de_grace
[finish]
Fluffy_Pillow 73.2/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:55.252Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:56.256Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:57.261Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit
3:58.267Neviscerate
[finish]
Fluffy_Pillow 58.2/100 58% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:59.273Ebackstab
[build]
Fluffy_Pillow 68.9/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
4:00.276Ebackstab
[build]
Fluffy_Pillow 47.6/100 48% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:01.509Neviscerate
[finish]
Fluffy_Pillow 36.7/100 37% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
4:02.514Ebackstab
[build]
Fluffy_Pillow 55.5/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_crit
4:03.951Ksecret_technique
[finish]
Fluffy_Pillow 30.8/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
4:04.955Rvanish
[stealth_cds]
Combo 1 50.5/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:04.955Dshadowstrike
[build]
Fluffy_Pillow 50.5/100 50% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), premeditation, shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:07.085Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:08.088Ebackstab
[build]
Fluffy_Pillow 46.9/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:10.930Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
4:12.906Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
4:13.910Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:16.304Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_crit
4:19.363Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_crit
4:22.375Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_crit
4:25.352Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), shadow_techniques(5), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:28.313Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), shadow_techniques(7), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:31.006Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 37.1/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), shadow_techniques(9), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:31.384Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), shadow_techniques(9), errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:32.388Jflagellation
[cds]
Fluffy_Pillow 15.4/100 15% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques(10), errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:34.007Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques(11), flagellation_buff, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:35.211Hsymbols_of_death
[cds]
Combo 1 77.8/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques(12), flagellation_buff(13), deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:35.211Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(12), the_rotten(2), flagellation_buff(13), deeper_daggers, poised_shadows, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:35.211Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), premeditation, shadow_techniques(12), the_rotten(2), flagellation_buff(13), deeper_daggers, poised_shadows, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:35.211Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), premeditation, shadow_techniques(12), the_rotten(2), flagellation_buff(13), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:36.216Ksecret_technique
[finish]
Fluffy_Pillow 73.5/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(14), the_rotten, flagellation_buff(13), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:37.222Ishadow_blades
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(7), shadow_techniques(9), the_rotten, flagellation_buff(23), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:37.222Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(7), shadow_techniques(9), the_rotten, flagellation_buff(23), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:38.226Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes(2), flawless_form(7), shadow_techniques(2), the_rotten, flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:39.231Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes(2), flawless_form(7), shadow_techniques(4), the_rotten, flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:40.236Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:41.240Dshadowstrike
[build]
Fluffy_Pillow 92.8/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:42.245Neviscerate
[finish]
Fluffy_Pillow 66.7/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(10), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:43.249Lrupture
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:44.255Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:44.255Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:44.255Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:45.259Neviscerate
[finish]
Fluffy_Pillow 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:46.262Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(4), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:47.268Fcold_blood
[cds]
Combo 1 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(4), shadow_techniques(9), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:47.268Ksecret_technique
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(3), flawless_form(4), shadow_techniques(9), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:48.272Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:49.279Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:50.284Mcoup_de_grace
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:51.491Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:52.496Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:53.502Neviscerate
[finish]
Fluffy_Pillow 92.4/100 92% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:54.507Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
4:55.512Neviscerate
[finish]
Fluffy_Pillow 78.7/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
4:56.517Ebackstab
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
4:57.522Ebackstab
[build]
Fluffy_Pillow 63.2/100 63% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:58.526Neviscerate
[finish]
Fluffy_Pillow 41.9/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:59.530Ebackstab
[build]
Fluffy_Pillow 55.6/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
5:01.920Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), deeper_daggers, flask_of_alchemical_chaos_vers
5:04.841Hsymbols_of_death
[cds]
Combo 1 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
5:05.028Neviscerate
[finish]
Fluffy_Pillow 78.2/100 78% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
5:06.034Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
5:06.034Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
5:07.038Ksecret_technique
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
5:08.042Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
5:09.047Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:10.051Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:11.056Dshadowstrike
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:12.061Mcoup_de_grace
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:13.264Gpotion
[cds]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:13.264Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:14.267Lrupture
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:15.271Ebackstab
[build]
Fluffy_Pillow 95.3/100 95% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:16.277Ebackstab
[build]
Fluffy_Pillow 66.4/100 66% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:17.282Neviscerate
[finish]
Fluffy_Pillow 45.6/100 46% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:18.284Ebackstab
[build]
Fluffy_Pillow 51.7/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:20.400Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:22.925Ksecret_technique
[finish]
Fluffy_Pillow 35.1/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:23.927Ebackstab
[build]
Fluffy_Pillow 50.3/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:26.366Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:29.487Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form(3), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:30.491Hsymbols_of_death
[cds]
Combo 1 14.7/100 15% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form(4), shadow_techniques, flask_of_alchemical_chaos_vers, tempered_potion
5:30.491Mcoup_de_grace
[finish]
Fluffy_Pillow 54.7/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques, the_rotten(2), poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:31.695Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, flawless_form(9), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:32.699Qshadow_dance
[stealth_cds]
Combo 1 70.8/100 71% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, flawless_form(9), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:32.699Neviscerate
[finish]
Fluffy_Pillow 70.8/100 71% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, flawless_form(9), premeditation, the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:33.703Dshadowstrike
[build]
Fluffy_Pillow 89.5/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, flawless_form(9), premeditation, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:34.705Neviscerate
[finish]
Fluffy_Pillow 63.2/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, flawless_form(9), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:35.709Dshadowstrike
[build]
Fluffy_Pillow 82.0/100 82% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:36.714Neviscerate
[finish]
Fluffy_Pillow 47.8/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, flawless_form(7), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:37.720Dshadowstrike
[build]
Fluffy_Pillow 74.7/100 75% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), flawless_form(7), shadow_techniques(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:38.726Neviscerate
[finish]
Fluffy_Pillow 48.5/100 49% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion, storm_sewers_citrine
5:39.730Dshadowstrike
[build]
Fluffy_Pillow 59.5/100 60% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion, storm_sewers_citrine
5:40.735Ksecret_technique
[finish]
Fluffy_Pillow 33.5/100 33% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers, tempered_potion, storm_sewers_citrine
5:41.740Ebackstab
[build]
Fluffy_Pillow 49.6/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes(2), flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion, storm_sewers_citrine

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470361443490715598 (13526)
Stamina86452017699316856582113
Intellect12000012360120000
Spirit00000
Health353986033713000
Energy1001000
Combo Points770
Spell Power12360120000
Crit15.44%15.44%2405
Haste7.39%2.02%1336
Versatility10.93%8.31%6483
Attack Power3893635845938
Mastery37.36%33.49%3969
Armor166061660616606
Run Speed800
Leech3.00%3.00%0

Gear

Source Slot Average Item Level: 540.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 437, stats: { 648 Armor, +2,008 Sta, +532 Vers, +314 Mastery, +578 AgiInt }
Local Neck Silken Advisor's Favor
ilevel: 571, stats: { +5,034 Sta, +2,689 Vers, +556 Mastery }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 571, stats: { 2,099 Armor, +6,712 Sta, +685 Vers, +366 Mastery, +1,510 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 571, stats: { 3,053 Armor, +8,949 Sta, +451 Crit, +949 Vers, +2,014 AgiInt }
Local Waist Devourer's Taut Innards
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +731 Vers, +319 Mastery, +1,510 AgiInt }
Local Legs K'areshi Phantom's Leggings
ilevel: 571, stats: { 2,671 Armor, +8,949 Sta, +418 Crit, +983 Mastery, +2,014 AgiInt }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 571, stats: { 1,908 Armor, +6,712 Sta, +328 Vers, +723 Mastery, +1,510 AgiInt }
Local Wrists Rune-Branded Armbands
ilevel: 577, stats: { 1,571 Armor, +5,483 Sta, +797 unknown(24), +797 unknown(25), +1,198 AgiInt }
Local Hands K'areshi Phantom's Grips
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +741 Crit, +309 Haste, +1,510 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 619, stats: { +10,359 Sta }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 280, stats: { +100 Sta, +242 Vers, +90 Mastery }
Local Trinket1 Treacherous Transmitter
ilevel: 571, stats: { +1,001 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 437, stats: { +549 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 571, stats: { 1,222 Armor, +5,034 Sta, +248 Crit, +540 Mastery, +1,133 StrAgiInt }
Local Main Hand Blood-Kissed Kukri
ilevel: 571, weapon: { 1,545 - 2,576, 1.8 }, stats: { +1,007 Agi, +4,475 Sta, +500 Crit, +200 Vers }, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 577, weapon: { 1,633 - 2,724, 1.8 }, stats: { +1,065 Agi, +4,874 Sta, +709 unknown(24), +709 unknown(25) }, temporary_enchant: Ironclaw Sharpened Weapon

Profile

rogue="Combo 1"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824
neck=silken_advisors_favor,id=225575
shoulders=kareshi_phantoms_shoulderpads,id=212036
back=royal_emblem_of_nerubar,id=212446
chest=kareshi_phantoms_nexus_wraps,id=212041
wrists=runebranded_armbands,id=219334
hands=kareshi_phantoms_grips,id=212039
waist=devourers_taut_innards,id=212425
legs=kareshi_phantoms_leggings,id=212037
feet=kareshi_phantoms_netherwalkers,id=212040
finger1=cyrces_circlet,id=228411
finger2=acidic_attendants_loop,id=225728
trinket1=treacherous_transmitter,id=221023
trinket2=empowering_crystal_of_anubikkaj,id=219312
main_hand=bloodkissed_kukri,id=212395
off_hand=everforged_stabber,id=222438

# Gear Summary
# gear_ilvl=539.81
# gear_agility=15598
# gear_stamina=82113
# gear_attack_power=938
# gear_crit_rating=2358
# gear_haste_rating=1310
# gear_mastery_rating=3891
# gear_versatility_rating=6356
# gear_armor=16606
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 2 : 626,733 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
626,732.6626,732.61,210.9 / 0.193%86,444.3 / 13.8%21,052.0
Resource Out In Waiting APM Active
Energy29.729.512.24%56.9100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 2626,733
Auto Attack 0 (36,838)0.0% (5.9%)3.9122.48s2,815,6570

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 24,4923.9%349.21.00s20,96721,175Direct349.220,68341,71420,97117.4%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage349.19349.190.000.000.000.99020.00007,321,591.699,556,929.8223.39%21,174.5021,174.50
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.26%231.3816230620,682.7412,50633,02020,691.1019,80321,6584,785,3126,246,84623.40%
crit17.41%60.80359441,713.5825,86666,04041,750.7337,28647,7112,536,2803,310,08423.38%
miss16.33%57.0232880.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 12,3452.0%348.91.00s10,57910,647Direct348.910,44021,09210,58017.3%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage348.95348.950.000.000.000.99360.00003,691,656.084,818,659.1123.39%10,647.1510,647.15
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.32%231.4315631210,439.906,24716,63210,444.759,92510,9962,416,0473,154,00523.40%
crit17.33%60.48329421,091.8513,31033,26321,105.5418,94024,0271,275,6091,664,65423.37%
miss16.34%57.0331900.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 15,9212.5%74.73.70s63,88863,601Direct74.739,344102,08263,88339.1%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.6974.690.000.000.001.00450.00004,772,073.146,248,824.4823.63%63,601.3563,601.35
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.89%45.48256839,343.5231,06781,74339,346.6337,12541,5311,789,3102,344,04923.66%
crit39.11%29.221349102,081.8768,348208,131102,116.7592,907117,8272,982,7633,904,77623.63%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:74.68

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 39,923 (56,981)6.4% (9.1%)13.222.50s1,291,5971,072,370Direct39.5 (77.3)237,724474,335302,23227.2% (27.2%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.1939.490.000.000.001.20450.000011,934,103.5915,539,668.7423.20%1,072,370.271,072,370.27
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.76%28.731543237,724.2851,895888,922237,901.60148,640318,5366,830,9098,894,53323.20%
crit27.24%10.76223474,334.65108,1641,740,786474,325.06148,233833,4865,103,1946,645,13623.22%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.18
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 17,0572.7%0.00.00s00Direct37.8105,619212,866134,69927.1%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0037.830.000.000.000.00000.00005,096,208.655,096,208.650.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.89%27.571642105,618.7625,783385,646105,762.8163,006154,4202,910,7522,910,7520.00%
crit27.11%10.25323212,865.8151,566755,215213,684.7169,586371,4162,185,4572,185,4570.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Eviscerate 115,634 (165,565)18.4% (26.4%)68.04.39s726,776723,523Direct68.0 (134.7)395,610811,177507,76827.0% (27.0%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.0468.040.000.000.001.00450.000034,537,551.8744,929,508.7323.13%723,523.05723,523.05
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.03%49.693266395,609.6595,2361,102,982395,602.11306,311466,85519,653,64025,569,24423.14%
crit26.97%18.35737811,176.81190,4712,152,707812,302.85498,1511,167,02814,883,91219,360,26423.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.05

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 49,9308.0%66.64.49s223,7840Direct66.6173,590358,805223,82327.1%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.6466.640.000.000.000.00000.000014,912,354.2814,912,354.280.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.88%48.563269173,589.7045,403478,513173,635.92143,653209,0398,428,1348,428,1340.00%
crit27.12%18.07632358,804.7190,806942,254358,586.98224,218490,9366,484,2216,484,2210.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 550 (11,081)0.1% (1.8%)3.791.39s893,530889,585Direct3.7 (27.5)37,65375,36844,24817.6% (17.5%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000164,238.06164,238.060.00%889,584.82889,584.82
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.42%3.060437,653.3533,12671,90537,555.82051,510115,112115,1120.00%
crit17.58%0.650375,368.2266,251143,80938,035.300143,80949,12649,1260.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.71
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 10,5311.7%0.00.00s00Direct23.8112,965223,604132,38917.5%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.790.000.000.000.00000.00003,149,465.403,149,465.400.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.45%19.621127112,964.8742,086235,151112,915.5891,192129,6882,216,1362,216,1360.00%
crit17.55%4.17013223,603.8686,577470,301221,123.990360,696933,330933,3300.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 6,4151.0%0.00.00s00Direct280.05,82111,7266,84917.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00279.970.000.000.000.00000.00001,917,627.121,917,627.120.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.58%231.201583145,820.814,0859,0135,822.485,4496,2461,345,7051,345,7050.00%
crit17.42%48.78238511,726.308,17118,02611,736.2510,36713,229571,922571,9220.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 43,779 (51,813)7.0% (8.3%)9.531.32s1,627,9361,620,741Periodic164.8 (329.5)61,820128,58079,43526.4% (26.3%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.510.00164.77164.777.051.00451.764113,088,293.3013,088,293.300.00%51,592.191,620,740.68
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.61%121.298415861,819.6031191,09961,866.6354,58968,6897,497,3207,497,3200.00%
crit26.39%43.492269128,580.3537375,007128,759.88103,222164,2315,590,9735,590,9730.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.51
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 8,0341.3%164.81.78s14,5720Periodic164.811,35923,63614,57626.2%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage164.770.000.00164.770.000.00000.00002,401,125.422,401,125.420.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.80%121.618215911,358.614,36835,04011,368.179,98912,7491,381,3941,381,3940.00%
crit26.20%43.16246823,635.988,73669,29923,653.4618,20630,2811,019,7321,019,7320.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (123,878)0.0% (19.8%)15.919.09s2,322,3202,311,941

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.940.000.000.000.001.00450.00000.000.000.00%2,311,940.842,311,940.84

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.94
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 31,7415.1%0.00.00s00Direct15.9309,900995,456595,16941.6%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.940.000.000.000.00000.00009,484,413.7312,366,000.9723.30%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.43%9.31315309,899.6168,025752,624310,269.77207,655427,3242,885,3963,773,92723.55%
crit41.57%6.63313995,456.33136,5141,851,6271,017,460.08642,4021,513,3536,599,0188,592,07423.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 92,13714.7%0.00.00s00Direct31.8449,7471,424,570866,94642.8%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.760.000.000.000.00000.000027,532,071.0627,532,071.060.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.23%18.181028449,746.56100,4351,088,384450,435.49314,916623,6178,174,6938,174,6930.00%
crit42.77%13.597221,424,570.45200,1892,677,6721,438,492.91813,6422,038,21219,357,37819,357,3780.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (50,351)0.0% (8.0%)3.690.90s4,124,7560

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 50,3518.0%382.61.21s39,3350Periodic382.639,328039,3280.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage382.610.000.00382.610.000.00000.000015,050,205.7915,050,205.790.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%382.6128747139,328.0936488,23339,371.6731,67345,86115,050,20615,050,2060.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1921.15
  • base_dd_max:1921.15
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 62,89710.0%52.25.84s359,607357,999Direct52.2151,511494,076359,58960.8%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2052.200.000.000.001.00450.000018,770,603.6824,482,986.6023.33%357,999.00357,999.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit39.25%20.491133151,511.2370,824214,623151,497.61136,894167,1713,103,8804,044,13723.25%
crit60.75%31.712244494,076.09155,814724,353494,536.89452,764539,18515,666,72420,438,85023.35%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.20

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Unseen Blade 44,9947.2%57.65.21s233,3840Direct57.6198,317398,590233,41717.5%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.6257.620.000.000.000.00000.000013,447,773.1717,575,857.9923.49%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.48%47.533170198,317.41120,067291,076198,435.20185,044213,8119,425,38112,318,56823.49%
crit17.52%10.09222398,590.22240,134582,152399,174.93296,320526,8974,022,3935,257,29023.50%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 2
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.76s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.58
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.51s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.720.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5307.14s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.47
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.63.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.580.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.323.20s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.260.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.26
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 14.221.33s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.25
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.48s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.91
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1583.0176.1s0.5s274.2s99.94%100.00%573.2 (573.2)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.8s / 344.0s
  • trigger_min/max:0.0s / 4.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 359.9s
  • uptime_min/max:99.13% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.24%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.29%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.481.7115.1s3.5s123.8s97.17%0.00%73.1 (75.9)1.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.2s / 348.5s
  • trigger_min/max:1.0s / 44.4s
  • trigger_pct:100.00%
  • duration_min/max:2.2s / 357.9s
  • uptime_min/max:85.63% / 99.44%

Stack Uptimes

  • alacrity_1:3.12%
  • alacrity_2:2.31%
  • alacrity_3:1.87%
  • alacrity_4:1.70%
  • alacrity_5:88.17%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.55%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.55%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows15.90.019.0s19.0s6.9s36.91%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.7s
  • trigger_min/max:9.2s / 56.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.73% / 41.72%

Stack Uptimes

  • bolstering_shadows_1:36.91%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.2s0.00%1.43%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.4s / 100.3s
  • trigger_min/max:83.4s / 100.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 0.2s
  • uptime_min/max:0.00% / 0.09%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0130.4s109.6s4.4s1.87%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.3s
  • trigger_min/max:90.0s / 189.9s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 15.0s
  • uptime_min/max:0.00% / 7.28%

Stack Uptimes

  • cryptic_instructions_1:1.87%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.347.723.2s23.2s8.2s36.40%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 69.2s
  • trigger_min/max:8.0s / 69.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.79% / 38.85%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.62%
  • danse_macabre_4:16.53%
  • danse_macabre_5:8.66%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.673.640.4s3.7s35.2s89.84%95.59%73.6 (73.6)6.7

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 167.2s
  • trigger_min/max:1.0s / 38.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 160.2s
  • uptime_min/max:81.64% / 96.55%

Stack Uptimes

  • deeper_daggers_1:89.84%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes15.90.019.0s19.0s3.4s18.32%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.7s
  • trigger_min/max:9.2s / 56.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:14.60% / 21.76%

Stack Uptimes

  • disorienting_strikes_1:12.17%
  • disorienting_strikes_2:6.15%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0126.4s110.1s4.0s1.69%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.8s
  • trigger_min/max:90.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 10.6s
  • uptime_min/max:0.00% / 6.71%

Stack Uptimes

  • errant_manaforge_emission_1:1.70%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.043.622.2s5.2s17.5s81.79%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.5s / 62.2s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.2s
  • uptime_min/max:64.90% / 93.61%

Stack Uptimes

  • escalating_blade_1:25.01%
  • escalating_blade_2:22.10%
  • escalating_blade_3:22.69%
  • escalating_blade_4:11.99%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.8s18.24%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:9013.45

Trigger Details

  • interval_min/max:84.3s / 185.1s
  • trigger_min/max:84.3s / 185.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s
  • uptime_min/max:12.56% / 20.82%

Stack Uptimes

  • ethereal_powerlink_1:18.24%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.723.991.3s9.7s11.8s14.69%0.00%14.2 (95.7)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.1s
  • trigger_min/max:1.0s / 94.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.94% / 16.88%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.04%
  • flagellation_buff_8:0.78%
  • flagellation_buff_9:0.62%
  • flagellation_buff_10:0.55%
  • flagellation_buff_11:0.44%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.03%
  • flagellation_buff_18:0.06%
  • flagellation_buff_19:0.43%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.20%
  • flagellation_buff_25:0.85%
  • flagellation_buff_26:0.36%
  • flagellation_buff_27:0.21%
  • flagellation_buff_28:0.22%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.08%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.27%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.2s / 98.1s
  • trigger_min/max:78.2s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s
  • uptime_min/max:12.35% / 16.26%

Stack Uptimes

  • flagellation_persist_1:0.00%
  • flagellation_persist_26:0.00%
  • flagellation_persist_30:14.27%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.7110.6s75.5s35.5s25.25%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 342.7s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 70.38%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.25%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6109.8s75.2s35.8s25.34%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 264.1s
  • uptime_min/max:0.00% / 83.64%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.34%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6110.1s77.4s34.7s24.69%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 349.6s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 78.77%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.69%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6114.3s78.3s35.0s24.72%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 335.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 152.0s
  • uptime_min/max:0.00% / 78.59%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.72%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form86.70.040.2s3.4s59.1s95.28%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.82%
  • flawless_form_2:8.84%
  • flawless_form_3:11.84%
  • flawless_form_4:9.69%
  • flawless_form_5:2.61%
  • flawless_form_6:4.55%
  • flawless_form_7:5.93%
  • flawless_form_8:11.24%
  • flawless_form_9:18.39%
  • flawless_form_10:8.65%
  • flawless_form_11:1.39%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.15%
  • flawless_form_16:0.08%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.287.9s73.9s16.8s10.72%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.2s / 302.7s
  • trigger_min/max:0.1s / 302.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 59.6s
  • uptime_min/max:0.00% / 41.74%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.72%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.0s73.5s17.0s10.88%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:5.0s / 330.5s
  • trigger_min/max:0.5s / 330.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.4s
  • uptime_min/max:0.00% / 44.68%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.88%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.290.3s77.7s16.8s10.79%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:1.3s / 343.4s
  • trigger_min/max:0.2s / 343.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.4s
  • uptime_min/max:0.00% / 43.79%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.79%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.285.5s71.0s17.1s10.90%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:1.5s / 306.8s
  • trigger_min/max:0.2s / 306.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 66.9s
  • uptime_min/max:0.00% / 40.98%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.90%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.7s17.18%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 89.4s
  • trigger_min/max:1.0s / 65.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.5s
  • uptime_min/max:8.61% / 26.92%

Stack Uptimes

  • poised_shadows_1:17.18%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.62%11.25%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 66.9s
  • trigger_min/max:1.0s / 66.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 3.3s
  • uptime_min/max:0.63% / 4.64%

Stack Uptimes

  • premeditation_1:2.62%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0128.9s110.1s3.9s1.58%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.0s
  • trigger_min/max:90.0s / 188.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.5s
  • uptime_min/max:0.00% / 7.47%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.58%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow Blades3.60.090.9s90.9s15.8s19.27%17.32%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 100.9s
  • trigger_min/max:90.0s / 100.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 16.0s
  • uptime_min/max:16.85% / 21.87%

Stack Uptimes

  • shadow_blades_1:19.27%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.2s23.2s8.2s36.40%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 69.2s
  • trigger_min/max:8.0s / 69.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.79% / 38.85%

Stack Uptimes

  • shadow_dance_1:36.40%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques67.7136.24.4s1.5s3.5s79.04%95.43%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 49.9s
  • trigger_min/max:0.5s / 6.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.8s
  • uptime_min/max:71.29% / 85.94%

Stack Uptimes

  • shadow_techniques_1:20.53%
  • shadow_techniques_2:21.03%
  • shadow_techniques_3:9.31%
  • shadow_techniques_4:10.51%
  • shadow_techniques_5:5.97%
  • shadow_techniques_6:5.80%
  • shadow_techniques_7:2.55%
  • shadow_techniques_8:2.32%
  • shadow_techniques_9:0.51%
  • shadow_techniques_10:0.45%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.2s99.32%85.88%98.6 (98.6)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.30.0102.2s96.1s9.9s1.11%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:1.0s / 323.3s
  • trigger_min/max:1.0s / 270.5s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 18.6s
  • uptime_min/max:0.00% / 11.40%

Stack Uptimes

  • storm_sewers_citrine_1:1.11%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s11.06%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 65.1s
  • trigger_min/max:3.0s / 65.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:8.56% / 14.28%

Stack Uptimes

  • supercharge_1_1:11.06%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.05%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.1s
  • trigger_min/max:1.0s / 65.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.8s
  • uptime_min/max:0.57% / 6.21%

Stack Uptimes

  • supercharge_2_1:2.05%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.1s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.0s
  • uptime_min/max:0.00% / 0.68%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.4s21.3s24.5s61.18%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 97.3s
  • trigger_min/max:1.0s / 65.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:57.45% / 65.75%

Stack Uptimes

  • symbols_of_death_1:61.18%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.6s307.6s27.5s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.1s
  • trigger_min/max:300.0s / 329.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.95% / 18.10%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.81%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.70%22.39%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 65.1s
  • trigger_min/max:1.0s / 65.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:10.62% / 17.45%

Stack Uptimes

  • the_rotten_1:10.66%
  • the_rotten_2:3.04%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.09%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.8s
  • trigger_min/max:120.0s / 136.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.43%

Stack Uptimes

  • vanish_1:0.09%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)48.627.074.06.1s0.7s81.2s
Skyfury (Off Hand)48.825.077.06.0s0.7s63.3s
Supercharger secret_technique12.48.016.023.7s9.2s94.0s
Cold Blood secret_technique3.63.04.090.7s83.4s100.3s
Supercharger rupture0.30.02.0150.8s23.7s282.3s
Supercharger coup_de_grace2.70.09.078.0s9.2s324.1s
Supercharger eviscerate13.16.020.022.9s1.0s156.1s
CP Spent During Flagellation201.6137.0248.011.2s1.0s175.9s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.02%5.58%12.42%0.7s0.0s2.4s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 2
Energy RegenEnergy1,409.993,005.8634.00%2.13378.8111.19%
Improved AmbushCombo Points52.2033.314.59%0.6418.8836.18%
PremeditationCombo Points17.1656.717.80%3.3163.3952.78%
Relentless StrikesEnergy106.694,250.5848.08%39.84118.572.71%
Shadow BladesCombo Points22.00114.2915.73%5.2017.6913.40%
Shadow TechniquesEnergy355.201,224.6113.85%3.45196.1713.81%
Shadow TechniquesCombo Points84.77237.9532.75%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.09105.6214.54%7.000.000.00%
BackstabCombo Points74.6874.3110.23%0.990.380.51%
ShadowstrikeCombo Points52.20104.3614.36%2.000.040.04%
Symbols of DeathEnergy14.24360.364.08%25.30209.4236.75%
Usage Type Count Total Tot% Avg RPE APR
Combo 2
BackstabEnergy74.682,987.4033.58%40.0039.991,597.40
Coup de GraceEnergy13.18461.435.19%35.0035.0036,907.45
Coup de GraceCombo Points13.1890.0212.46%6.836.83189,176.81
EviscerateEnergy68.052,381.8426.78%35.0035.0120,761.24
EviscerateCombo Points68.05463.4264.12%6.816.81106,706.78
RuptureEnergy9.51237.872.67%25.0025.0065,118.33
RuptureCombo Points9.5165.079.00%6.846.84238,054.23
Secret TechniqueEnergy15.94478.225.38%30.0030.0077,404.39
Secret TechniqueCombo Points15.94104.2114.42%6.546.54355,194.97
ShadowstrikeEnergy52.202,348.8826.40%45.0045.007,991.30
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.5529.73902.245.90.1100.0
Combo Points0.02.432.41100.33.80.07.0

Statistics & Data Analysis

Fight Length
Combo 2 Fight Length
Count 1321
Mean 299.24
Minimum 240.10
Maximum 359.93
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Combo 2 Damage Per Second
Count 1321
Mean 626732.57
Minimum 559307.82
Maximum 685703.11
Spread ( max - min ) 126395.29
Range [ ( max - min ) / 2 * 100% ] 10.08%
Standard Deviation 22455.4177
5th Percentile 589754.76
95th Percentile 663538.08
( 95th Percentile - 5th Percentile ) 73783.33
Mean Distribution
Standard Deviation 617.8310
95.00% Confidence Interval ( 625521.64 - 627943.50 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4932
0.1 Scale Factor Error with Delta=300 4304533
0.05 Scale Factor Error with Delta=300 17218129
0.01 Scale Factor Error with Delta=300 430453206
Priority Target DPS
Combo 2 Priority Target Damage Per Second
Count 1321
Mean 626732.57
Minimum 559307.82
Maximum 685703.11
Spread ( max - min ) 126395.29
Range [ ( max - min ) / 2 * 100% ] 10.08%
Standard Deviation 22455.4177
5th Percentile 589754.76
95th Percentile 663538.08
( 95th Percentile - 5th Percentile ) 73783.33
Mean Distribution
Standard Deviation 617.8310
95.00% Confidence Interval ( 625521.64 - 627943.50 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4932
0.1 Scale Factor Error with Delta=300 4304533
0.05 Scale Factor Error with Delta=300 17218129
0.01 Scale Factor Error with Delta=300 430453206
DPS(e)
Combo 2 Damage Per Second (Effective)
Count 1321
Mean 626732.57
Minimum 559307.82
Maximum 685703.11
Spread ( max - min ) 126395.29
Range [ ( max - min ) / 2 * 100% ] 10.08%
Damage
Combo 2 Damage
Count 1321
Mean 187271356.04
Minimum 145081770.01
Maximum 226025398.60
Spread ( max - min ) 80943628.59
Range [ ( max - min ) / 2 * 100% ] 21.61%
DTPS
Combo 2 Damage Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 2 Healing Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 2 Healing Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 2 Heal
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 2 Healing Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.20 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 74.68 backstab
actions.cds
# count action,conditions
F 3.58 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.47 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.25 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.71 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.94 secret_technique,if=variable.secret
L 9.51 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.18 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.05 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.26 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.91 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNNDHMDFKNENNENNEEMHQDKNDNDNDLENEHQNDKDMDNDENEENEHQNDKNDNDMEEELEENENEEENEEOMEEEJHQPKDINDNNDNLHQDNDFKDMNDNNEENEENRDMELEHQKDNDNDDNENEENEEKEELEEEMEEENEENEOEJHQPKDINDNNDNELHQMDFKNDNDNENEEHQMDKDNDNDNEELEENENEHQKDMDNDDNENERENEKEEELEEEEEOEJMHQPDINKDNDNNEHLQNDNDFKDMNENEENENEHNENQDKDNDGMDNEENEENEHKELEENQDMDNDND

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, cryptic_instructions
0:01.004Gpotion
[cds]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes, flawless_form, the_first_dance, cryptic_instructions
0:01.004Jflagellation
[cds]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes, flawless_form, the_first_dance, cryptic_instructions, tempered_potion
0:02.009Neviscerate
[finish]
Fluffy_Pillow 87.6/100 88% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, cryptic_instructions, nascent_empowerment_Vers, tempered_potion
0:03.016Rvanish
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, tempered_potion
0:03.016Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(3), flawless_form, premeditation, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, tempered_potion
0:04.019Lrupture
[finish]
Fluffy_Pillow 73.5/100 74% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(7), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, tempered_potion
0:05.026Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, cryptic_instructions, nascent_empowerment_Vers, tempered_potion
0:05.026Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(9), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Vers, tempered_potion
0:05.026Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(9), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Vers, tempered_potion
0:05.026Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(9), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:06.031Ishadow_blades
[cds]
Combo 2 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:06.031Ksecret_technique
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:07.038Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:08.041Neviscerate
[finish]
Fluffy_Pillow 77.8/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:09.044Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:10.048Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:11.050Neviscerate
[finish]
Fluffy_Pillow 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:12.053Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:13.057Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:14.059Hsymbols_of_death
[cds]
Combo 2 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:14.059Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, flawless_form(4), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:15.264Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(9), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:16.267Fcold_blood
[cds]
Combo 2 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(11), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:16.267Ksecret_technique
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(11), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:17.272Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(11), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:18.276Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:19.281Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:20.285Neviscerate
[finish]
Fluffy_Pillow 97.1/100 97% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:21.288Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:22.294Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:23.299Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:24.303Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:25.308Ebackstab
[build]
Fluffy_Pillow 82.6/100 83% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:26.313Mcoup_de_grace
[finish]
Fluffy_Pillow 65.1/100 65% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:27.517Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:27.517Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:27.517Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:28.521Ksecret_technique
[finish]
Fluffy_Pillow 77.5/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:29.526Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(9), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:30.529Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
0:31.534Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:32.539Dshadowstrike
[build]
Fluffy_Pillow 99.3/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:33.543Neviscerate
[finish]
Fluffy_Pillow 76.2/100 76% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:34.547Dshadowstrike
[build]
Fluffy_Pillow 98.2/100 98% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:35.552Lrupture
[finish]
Fluffy_Pillow 83.2/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
0:36.557Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_crit
0:37.561Neviscerate
[finish]
Fluffy_Pillow 82.0/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_crit
0:38.567Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:39.571Hsymbols_of_death
[cds]
Combo 2 90.0/100 90% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:39.571Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:39.571Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
3.0/7 43% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:40.576Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:41.580Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:42.583Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
0:43.587Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:44.790Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:45.794Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:46.798Dshadowstrike
[build]
Fluffy_Pillow 84.5/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:47.802Ebackstab
[build]
Fluffy_Pillow 58.4/100 58% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
0:48.808Neviscerate
[finish]
Fluffy_Pillow 37.7/100 38% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
0:49.816Ebackstab
[build]
Fluffy_Pillow 49.1/100 49% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
0:51.267Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
0:53.655Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
0:54.659Ebackstab
[build]
Fluffy_Pillow 55.7/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
0:55.661Hsymbols_of_death
[cds]
Combo 2 35.0/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
0:55.661Qshadow_dance
[stealth_cds]
Combo 2 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
0:55.661Neviscerate
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
0:56.666Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
0:57.670Ksecret_technique
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
0:58.674Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(3), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
0:59.680Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:00.683Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:01.685Dshadowstrike
[build]
Fluffy_Pillow 85.6/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:02.689Mcoup_de_grace
[finish]
Fluffy_Pillow 59.9/100 60% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:03.892Ebackstab
[build]
Fluffy_Pillow 93.5/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
1:04.896Ebackstab
[build]
Fluffy_Pillow 64.8/100 65% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_haste
1:05.899Ebackstab
[build]
Fluffy_Pillow 44.1/100 44% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:07.173Lrupture
[finish]
Fluffy_Pillow 26.5/100 26% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:08.179Ebackstab
[build]
Fluffy_Pillow 47.8/100 48% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:09.699Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
1:11.714Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), flask_of_alchemical_chaos_haste
1:12.719Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
1:14.615Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:15.619Ebackstab
[build]
Fluffy_Pillow 42.7/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:18.714Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:21.535Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:23.923Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_haste
1:24.930Ebackstab
[build]
Fluffy_Pillow 47.7/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:27.120Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:29.954Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:30.000Mcoup_de_grace
[finish]
Fluffy_Pillow 36.7/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques, deeper_daggers, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:31.205Ebackstab
[build]
Fluffy_Pillow 73.7/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques(2), deeper_daggers, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:32.211Ebackstab
[build]
Fluffy_Pillow 44.7/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), deeper_daggers, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:34.827Ebackstab
[build]
Fluffy_Pillow 45.0/100 45% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:35.833Jflagellation
[cds]
Fluffy_Pillow 19.9/100 20% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.837Hsymbols_of_death
[cds]
Combo 2 30.8/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form(7), shadow_techniques(2), flagellation_buff, deeper_daggers, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.837Qshadow_dance
[stealth_cds]
Combo 2 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.837Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.837Ksecret_technique
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:37.843Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:38.846Ishadow_blades
[cds]
Combo 2 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_buff(11), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:38.846Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_buff(11), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:39.851Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(6), the_rotten, flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:40.855Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(9), shadow_techniques(8), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:41.859Neviscerate
[finish]
Fluffy_Pillow 93.2/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(9), shadow_techniques(3), flagellation_buff(28), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:42.865Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:43.871Neviscerate
[finish]
Fluffy_Pillow 74.2/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:44.875Lrupture
[finish]
Fluffy_Pillow 93.6/100 94% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:45.880Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:45.880Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:45.880Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:46.887Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
1:47.891Dshadowstrike
[build]
Fluffy_Pillow 92.5/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:48.895Fcold_blood
[cds]
Combo 2 58.3/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:48.895Ksecret_technique
[finish]
Fluffy_Pillow 58.3/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:49.900Dshadowstrike
[build]
Fluffy_Pillow 97.1/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:50.903Mcoup_de_grace
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:52.107Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:53.112Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:54.118Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:55.122Neviscerate
[finish]
Fluffy_Pillow 84.5/100 85% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:56.126Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:57.132Ebackstab
[build]
Fluffy_Pillow 78.8/100 79% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:58.139Neviscerate
[finish]
Fluffy_Pillow 57.6/100 58% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
1:59.145Ebackstab
[build]
Fluffy_Pillow 63.3/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:00.149Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:02.572Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:03.576Rvanish
[stealth_cds]
Combo 2 45.8/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
2:03.576Dshadowstrike
[build]
Fluffy_Pillow 45.8/100 46% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
2:06.525Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:07.730Ebackstab
[build]
Fluffy_Pillow 78.3/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
2:08.733Lrupture
[finish]
Fluffy_Pillow 53.1/100 53% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:09.736Ebackstab
[build]
Fluffy_Pillow 72.8/100 73% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:10.739Hsymbols_of_death
[cds]
Combo 2 43.5/100 44% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), deeper_daggers, flask_of_alchemical_chaos_vers
2:10.739Qshadow_dance
[stealth_cds]
Combo 2 83.5/100 84% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:10.739Ksecret_technique
[finish]
Fluffy_Pillow 83.5/100 84% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), premeditation, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:11.742Dshadowstrike
[build]
Fluffy_Pillow 94.3/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(8), premeditation, the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
2:12.744Neviscerate
[finish]
Fluffy_Pillow 68.0/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:13.747Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:14.751Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:15.756Dshadowstrike
[build]
Fluffy_Pillow 84.5/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:16.761Dshadowstrike
[build]
Fluffy_Pillow 66.3/100 66% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:18.158Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:19.162Ebackstab
[build]
Fluffy_Pillow 55.0/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
2:20.400Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:21.405Ebackstab
[build]
Fluffy_Pillow 55.0/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:23.259Ebackstab
[build]
Fluffy_Pillow 42.9/100 43% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:25.215Neviscerate
[finish]
Fluffy_Pillow 35.9/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:26.220Ebackstab
[build]
Fluffy_Pillow 46.6/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:28.677Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:31.149Ksecret_technique
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
2:32.154Ebackstab
[build]
Fluffy_Pillow 51.2/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:34.587Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_vers
2:36.522Lrupture
[finish]
Fluffy_Pillow 26.0/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_vers
2:37.525Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_vers
2:40.577Ebackstab
[build]
Fluffy_Pillow 42.4/100 42% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flask_of_alchemical_chaos_vers
2:43.728Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_vers
2:46.731Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, flask_of_alchemical_chaos_vers
2:47.935Ebackstab
[build]
Fluffy_Pillow 78.2/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:48.938Ebackstab
[build]
Fluffy_Pillow 53.0/100 53% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:51.188Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:54.082Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:55.085Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:57.402Ebackstab
[build]
Fluffy_Pillow 43.7/100 44% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:59.992Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
3:00.998Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:03.992Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
3:03.992Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
3:05.795Jflagellation
[cds]
Fluffy_Pillow 24.6/100 25% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
3:06.839Hsymbols_of_death
[cds]
Combo 2 35.8/100 36% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
3:06.839Qshadow_dance
[stealth_cds]
Combo 2 75.8/100 76% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
3:06.839Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 75.8/100 76% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
3:06.839Ksecret_technique
[finish]
Fluffy_Pillow 75.8/100 76% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:07.844Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:08.848Ishadow_blades
[cds]
Combo 2 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:08.848Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:09.853Dshadowstrike
[build]
Fluffy_Pillow 99.5/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:10.858Neviscerate
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:11.862Neviscerate
[finish]
Fluffy_Pillow 92.0/100 92% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:12.866Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:13.869Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:14.873Ebackstab
[build]
Fluffy_Pillow 92.5/100 93% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:15.879Lrupture
[finish]
Fluffy_Pillow 79.3/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(10), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:16.883Hsymbols_of_death
[cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:16.883Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:16.883Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:18.088Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:19.094Fcold_blood
[cds]
Combo 2 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:19.094Ksecret_technique
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:20.098Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:21.102Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:22.107Neviscerate
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:23.112Dshadowstrike
[build]
Fluffy_Pillow 92.9/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:24.118Neviscerate
[finish]
Fluffy_Pillow 58.8/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:25.123Ebackstab
[build]
Fluffy_Pillow 77.8/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:26.130Neviscerate
[finish]
Fluffy_Pillow 48.8/100 49% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:27.135Ebackstab
[build]
Fluffy_Pillow 67.7/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:28.139Ebackstab
[build]
Fluffy_Pillow 46.6/100 47% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:29.145Hsymbols_of_death
[cds]
Combo 2 17.6/100 18% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques, flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:29.145Qshadow_dance
[stealth_cds]
Combo 2 57.6/100 58% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), shadow_techniques, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:29.145Mcoup_de_grace
[finish]
Fluffy_Pillow 57.6/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), premeditation, shadow_techniques, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:30.350Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(10), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:31.354Ksecret_technique
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:32.357Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:33.362Neviscerate
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:34.366Dshadowstrike
[build]
Fluffy_Pillow 92.9/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(7), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:35.370Neviscerate
[finish]
Fluffy_Pillow 58.8/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:36.376Dshadowstrike
[build]
Fluffy_Pillow 77.8/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:37.379Neviscerate
[finish]
Fluffy_Pillow 43.7/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:38.382Ebackstab
[build]
Fluffy_Pillow 62.6/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:39.387Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:40.952Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:41.958Ebackstab
[build]
Fluffy_Pillow 46.9/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:43.666Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
3:45.454Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(5), flask_of_alchemical_chaos_mastery
3:46.460Ebackstab
[build]
Fluffy_Pillow 54.9/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_mastery
3:48.031Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:49.037Ebackstab
[build]
Fluffy_Pillow 50.5/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
3:50.043Hsymbols_of_death
[cds]
Combo 2 25.3/100 25% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
3:50.043Qshadow_dance
[stealth_cds]
Combo 2 65.3/100 65% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:50.043Ksecret_technique
[finish]
Fluffy_Pillow 65.3/100 65% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:51.048Dshadowstrike
[build]
Fluffy_Pillow 81.0/100 81% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:52.054Mcoup_de_grace
[finish]
Fluffy_Pillow 54.8/100 55% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:53.258Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:54.262Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:55.268Dshadowstrike
[build]
Fluffy_Pillow 76.5/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:56.273Dshadowstrike
[build]
Fluffy_Pillow 50.3/100 50% energy
4.0/7 57% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:58.392Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
3:59.397Ebackstab
[build]
Fluffy_Pillow 54.8/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_mastery
4:00.556Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
4:01.559Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
4:03.673Rvanish
[stealth_cds]
Combo 2 40.6/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
4:03.673Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
3.0/7 43% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), premeditation, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
4:06.391Neviscerate
[finish]
Fluffy_Pillow 37.7/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
4:07.393Ebackstab
[build]
Fluffy_Pillow 48.4/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
4:09.111Ksecret_technique
[finish]
Fluffy_Pillow 30.8/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:10.116Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:13.202Ebackstab
[build]
Fluffy_Pillow 42.7/100 43% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:16.804Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_mastery
4:18.395Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, flask_of_alchemical_chaos_mastery
4:19.399Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, flask_of_alchemical_chaos_mastery
4:21.860Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), flask_of_alchemical_chaos_mastery
4:24.782Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_mastery
4:28.240Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_mastery
4:31.616Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), shadow_techniques(3), flask_of_alchemical_chaos_mastery
4:34.077Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), shadow_techniques(5), flask_of_alchemical_chaos_mastery
4:34.635Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), shadow_techniques(5), cryptic_instructions, flask_of_alchemical_chaos_mastery
4:35.641Jflagellation
[cds]
Fluffy_Pillow 15.0/100 15% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques(6), cryptic_instructions, flask_of_alchemical_chaos_mastery
4:37.676Mcoup_de_grace
[finish]
Fluffy_Pillow 39.7/100 40% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques(7), flagellation_buff, cryptic_instructions, flask_of_alchemical_chaos_mastery
4:38.880Hsymbols_of_death
[cds]
Combo 2 77.1/100 77% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(6), shadow_techniques(7), flagellation_buff(13), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_mastery
4:38.880Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(7), the_rotten(2), flagellation_buff(13), deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_mastery
4:38.880Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), premeditation, shadow_techniques(7), the_rotten(2), flagellation_buff(13), deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_mastery
4:38.880Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), premeditation, shadow_techniques(7), the_rotten(2), flagellation_buff(13), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:39.882Ishadow_blades
[cds]
Combo 2 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(9), the_rotten, flagellation_buff(13), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:39.882Neviscerate
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(9), the_rotten, flagellation_buff(13), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:40.886Ksecret_technique
[finish]
Fluffy_Pillow 98.7/100 99% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, flawless_form(6), shadow_techniques(2), the_rotten, flagellation_buff(23), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:41.891Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes(2), flawless_form(7), shadow_techniques(4), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:42.894Neviscerate
[finish]
Fluffy_Pillow 73.5/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
4:43.898Dshadowstrike
[build]
Fluffy_Pillow 92.1/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
4:44.902Neviscerate
[finish]
Fluffy_Pillow 57.7/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
4:45.905Neviscerate
[finish]
Fluffy_Pillow 76.4/100 76% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
4:46.909Ebackstab
[build]
Fluffy_Pillow 95.1/100 95% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
4:47.914Hsymbols_of_death
[cds]
Combo 2 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:47.914Lrupture
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(9), shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:48.918Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:48.918Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), premeditation, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:49.922Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:50.927Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:51.930Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:52.934Fcold_blood
[cds]
Combo 2 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:52.934Ksecret_technique
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:53.939Dshadowstrike
[build]
Fluffy_Pillow 81.8/100 82% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:54.946Mcoup_de_grace
[finish]
Fluffy_Pillow 55.6/100 56% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:56.150Neviscerate
[finish]
Fluffy_Pillow 93.4/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:57.154Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:58.158Neviscerate
[finish]
Fluffy_Pillow 78.7/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:59.163Ebackstab
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
5:00.166Ebackstab
[build]
Fluffy_Pillow 71.1/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
5:01.173Neviscerate
[finish]
Fluffy_Pillow 49.9/100 50% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
5:02.177Ebackstab
[build]
Fluffy_Pillow 68.6/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:03.181Neviscerate
[finish]
Fluffy_Pillow 47.3/100 47% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:04.185Ebackstab
[build]
Fluffy_Pillow 53.0/100 53% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:05.189Hsymbols_of_death
[cds]
Combo 2 23.7/100 24% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:05.189Neviscerate
[finish]
Fluffy_Pillow 63.7/100 64% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:06.194Ebackstab
[build]
Fluffy_Pillow 77.4/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(6), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:07.199Neviscerate
[finish]
Fluffy_Pillow 48.1/100 48% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:08.203Qshadow_dance
[stealth_cds]
Combo 2 61.8/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:08.203Dshadowstrike
[build]
Fluffy_Pillow 61.8/100 62% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:09.207Ksecret_technique
[finish]
Fluffy_Pillow 35.6/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:10.212Dshadowstrike
[build]
Fluffy_Pillow 59.3/100 59% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:11.505Neviscerate
[finish]
Fluffy_Pillow 44.1/100 44% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:12.510Dshadowstrike
[build]
Fluffy_Pillow 54.8/100 55% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:13.514Gpotion
[cds]
Fluffy_Pillow 28.5/100 28% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
5:14.103Mcoup_de_grace
[finish]
Fluffy_Pillow 35.0/100 35% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers, tempered_potion
5:15.307Dshadowstrike
[build]
Fluffy_Pillow 81.4/100 81% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers, tempered_potion
5:16.311Neviscerate
[finish]
Fluffy_Pillow 47.5/100 48% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers, tempered_potion
5:17.317Ebackstab
[build]
Fluffy_Pillow 66.7/100 67% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers, tempered_potion
5:18.645Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
5:21.004Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit, tempered_potion
5:22.008Ebackstab
[build]
Fluffy_Pillow 41.9/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:24.806Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:27.286Neviscerate
[finish]
Fluffy_Pillow 36.7/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:28.292Ebackstab
[build]
Fluffy_Pillow 42.9/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:29.862Hsymbols_of_death
[cds]
Combo 2 28.4/100 28% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:30.027Ksecret_technique
[finish]
Fluffy_Pillow 70.2/100 70% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:31.031Ebackstab
[build]
Fluffy_Pillow 89.4/100 89% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:32.036Lrupture
[finish]
Fluffy_Pillow 68.6/100 69% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:33.041Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:34.045Ebackstab
[build]
Fluffy_Pillow 79.2/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:35.049Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:36.054Qshadow_dance
[stealth_cds]
Combo 2 69.6/100 70% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:36.054Dshadowstrike
[build]
Fluffy_Pillow 69.6/100 70% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
5:37.057Mcoup_de_grace
[finish]
Fluffy_Pillow 43.7/100 44% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:38.261Dshadowstrike
[build]
Fluffy_Pillow 90.1/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
5:39.265Neviscerate
[finish]
Fluffy_Pillow 64.3/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
5:40.269Dshadowstrike
[build]
Fluffy_Pillow 83.5/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
5:41.271Neviscerate
[finish]
Fluffy_Pillow 49.7/100 50% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
5:42.276Dshadowstrike
[build]
Fluffy_Pillow 68.9/100 69% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470361443490715598 (13526)
Stamina86452017689116846882016
Intellect12000012360120000
Spirit00000
Health353782033693600
Energy1001000
Combo Points770
Spell Power12360120000
Crit20.50%15.44%2409
Haste1.58%2.02%1336
Versatility11.00%8.00%6243
Attack Power3893635845938
Mastery37.04%33.17%3877
Armor166061660616606
Run Speed800
Leech3.00%3.00%0

Gear

Source Slot Average Item Level: 525.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 437, stats: { 648 Armor, +2,008 Sta, +532 Vers, +314 Mastery, +578 AgiInt }
Local Neck Silken Advisor's Favor
ilevel: 571, stats: { +5,034 Sta, +2,689 Vers, +556 Mastery }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 571, stats: { 2,099 Armor, +6,712 Sta, +685 Vers, +366 Mastery, +1,510 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 571, stats: { 3,053 Armor, +8,949 Sta, +451 Crit, +949 Vers, +2,014 AgiInt }
Local Waist Devourer's Taut Innards
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +731 Vers, +319 Mastery, +1,510 AgiInt }
Local Legs K'areshi Phantom's Leggings
ilevel: 571, stats: { 2,671 Armor, +8,949 Sta, +418 Crit, +983 Mastery, +2,014 AgiInt }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 571, stats: { 1,908 Armor, +6,712 Sta, +328 Vers, +723 Mastery, +1,510 AgiInt }
Local Wrists Rune-Branded Armbands
ilevel: 577, stats: { 1,571 Armor, +5,483 Sta, +797 unknown(24), +797 unknown(25), +1,198 AgiInt }
Local Hands K'areshi Phantom's Grips
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +741 Crit, +309 Haste, +1,510 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 619, stats: { +10,359 Sta }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Ring of Dun Algaz
ilevel: 37, stats: { +3 Sta, +4 Crit, +7 Vers }
Local Trinket1 Treacherous Transmitter
ilevel: 571, stats: { +1,001 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 437, stats: { +549 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 571, stats: { 1,222 Armor, +5,034 Sta, +248 Crit, +540 Mastery, +1,133 StrAgiInt }
Local Main Hand Blood-Kissed Kukri
ilevel: 571, weapon: { 1,545 - 2,576, 1.8 }, stats: { +1,007 Agi, +4,475 Sta, +500 Crit, +200 Vers }, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 577, weapon: { 1,633 - 2,724, 1.8 }, stats: { +1,065 Agi, +4,874 Sta, +709 unknown(24), +709 unknown(25) }, temporary_enchant: Ironclaw Sharpened Weapon

Profile

rogue="Combo 2"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824
neck=silken_advisors_favor,id=225575
shoulders=kareshi_phantoms_shoulderpads,id=212036
back=royal_emblem_of_nerubar,id=212446
chest=kareshi_phantoms_nexus_wraps,id=212041
wrists=runebranded_armbands,id=219334
hands=kareshi_phantoms_grips,id=212039
waist=devourers_taut_innards,id=212425
legs=kareshi_phantoms_leggings,id=212037
feet=kareshi_phantoms_netherwalkers,id=212040
finger1=cyrces_circlet,id=228411
finger2=ring_of_dun_algaz,id=133287
trinket1=treacherous_transmitter,id=221023
trinket2=empowering_crystal_of_anubikkaj,id=219312
main_hand=bloodkissed_kukri,id=212395
off_hand=everforged_stabber,id=222438

# Gear Summary
# gear_ilvl=524.63
# gear_agility=15598
# gear_stamina=82016
# gear_attack_power=938
# gear_crit_rating=2362
# gear_haste_rating=1310
# gear_mastery_rating=3801
# gear_versatility_rating=6121
# gear_armor=16606
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 3 : 626,387 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
626,387.0626,387.01,217.9 / 0.194%87,069.3 / 13.9%21,050.3
Resource Out In Waiting APM Active
Energy29.729.512.26%56.9100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 3626,387
Auto Attack 0 (36,762)0.0% (5.9%)3.9122.47s2,812,4370

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 24,4503.9%349.11.00s20,93821,148Direct349.120,69641,65720,93917.3%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage349.14349.140.000.000.000.99010.00007,310,175.129,542,443.9323.39%21,147.5421,147.54
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.34%231.6216130020,695.8312,54833,01820,705.2119,71421,9754,793,8316,258,05723.40%
crit17.30%60.42319241,656.9825,34566,03541,678.9636,95046,6032,516,3443,284,38723.39%
miss16.35%57.1033940.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 12,3132.0%348.41.00s10,56910,640Direct348.410,45021,07210,57017.3%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage348.37348.370.000.000.000.99330.00003,681,961.304,806,298.4123.39%10,640.4010,640.40
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.32%231.0516730310,450.416,26816,63010,455.819,93811,0642,414,6023,152,19823.40%
crit17.26%60.15329521,072.4313,24833,26121,088.2418,93324,0621,267,3591,654,10123.38%
miss16.41%57.1731900.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 15,9222.5%74.73.71s63,88563,600Direct74.739,328102,05863,86339.1%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.6974.690.000.000.001.00450.00004,771,580.276,248,377.4023.63%63,599.8763,599.87
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.85%45.45266739,327.8631,06589,19539,329.9537,20642,2511,787,4432,341,93423.66%
crit39.15%29.241352102,058.1268,343217,362102,082.0192,604114,7252,984,1383,906,44323.63%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:74.69

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 40,171 (57,311)6.4% (9.1%)13.222.47s1,296,3171,076,239Direct39.6 (77.4)238,505475,255303,55427.5% (27.3%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2139.550.000.000.001.20450.000012,004,140.4615,630,558.6423.20%1,076,238.881,076,238.88
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.52%28.691744238,504.9054,077870,325238,438.95163,988383,5876,841,2898,908,36123.21%
crit27.48%10.87323475,255.48108,1551,771,828477,101.32189,608931,8865,162,8516,722,19823.21%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.21
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 17,1412.7%0.00.00s00Direct37.9105,799214,318135,18927.1%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0037.880.000.000.000.00000.00005,118,820.195,118,820.190.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.93%27.631543105,799.2525,781384,341106,012.0372,003145,2812,922,4342,922,4340.00%
crit27.07%10.25221214,317.9951,562756,645214,843.2499,358408,6042,196,3872,196,3870.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Eviscerate 115,355 (165,037)18.4% (26.3%)67.94.40s725,607722,365Direct67.9 (134.4)395,597810,474507,22126.9% (26.9%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.9367.930.000.000.001.00450.000034,452,405.0144,819,242.2323.13%722,365.28722,365.28
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.08%49.642873395,597.2095,2281,097,722395,316.92325,289483,48619,628,63225,536,61423.14%
crit26.92%18.29535810,473.50190,4562,154,882811,385.13494,1831,129,57814,823,77319,282,62923.13%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:67.94

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 49,6827.9%66.54.49s223,1760Direct66.5174,097356,481223,24327.0%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.4966.490.000.000.000.00000.000014,838,912.0914,838,912.090.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.04%48.563268174,096.7245,399476,231174,138.57143,751207,6318,452,7608,452,7600.00%
crit26.96%17.93736356,481.4790,798933,008356,485.91229,204494,2266,386,1526,386,1520.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 552 (11,108)0.1% (1.8%)3.791.21s894,691890,818Direct3.7 (27.5)37,73475,58744,33617.5% (17.6%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000164,744.89164,744.890.00%890,817.67890,817.67
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.51%3.060437,734.4833,12373,03137,614.25054,344115,646115,6460.00%
crit17.49%0.650475,586.5866,246138,14938,133.700138,14949,09949,0990.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.72
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 10,5561.7%0.00.00s00Direct23.8113,008224,495132,62817.6%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.820.000.000.000.00000.00003,158,005.003,158,005.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.41%19.631027113,007.7042,226235,133112,929.9494,733129,1452,218,4222,218,4220.00%
crit17.59%4.19013224,495.3486,570470,266220,898.130423,327939,583939,5830.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 6,3951.0%0.00.00s00Direct279.45,82111,7346,84417.3%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00279.370.000.000.000.00000.00001,911,798.641,911,798.640.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.71%231.081553115,821.054,0859,0125,823.775,5376,1501,345,1401,345,1400.00%
crit17.29%48.30258611,733.568,17018,02511,739.6310,43013,192566,659566,6590.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 43,754 (51,808)7.0% (8.3%)9.531.21s1,628,8131,621,682Periodic164.9 (329.7)61,848128,61379,34626.2% (26.3%)0.0%97.2%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.510.00164.85164.857.021.00451.763513,077,681.9813,077,681.980.00%51,572.581,621,681.89
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.80%121.668616061,847.52117190,08661,864.7853,08270,6957,522,0397,522,0390.00%
crit26.20%43.192466128,613.1884375,444128,902.3598,127167,0175,555,6435,555,6430.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.51
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 8,0541.3%164.91.78s14,6060Periodic164.911,35923,66514,60826.4%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage164.850.000.00164.850.000.00000.00002,407,758.342,407,758.340.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.60%121.328716411,359.054,36734,85411,365.989,85812,8411,377,8081,377,8080.00%
crit26.40%43.53236923,665.308,73568,84223,683.3617,67430,9831,029,9511,029,9510.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (123,875)0.0% (19.8%)15.919.10s2,325,7302,315,375

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.920.000.000.000.001.00450.00000.000.000.00%2,315,374.812,315,374.81

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.92
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 31,8005.1%0.00.00s00Direct15.9309,652994,724597,11641.9%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.920.000.000.000.00000.00009,505,283.3012,394,315.2023.31%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.05%9.24315309,652.0368,020740,396309,829.98190,955434,3672,862,3253,744,28523.57%
crit41.95%6.68314994,724.21136,0401,862,5621,015,906.67628,5011,539,3466,642,9588,650,03123.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 92,07414.7%0.00.00s00Direct31.8450,3751,425,250866,96842.7%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.760.000.000.000.00000.000027,526,821.4427,526,821.440.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.28%18.191028450,375.20100,0861,070,700450,980.27322,675596,1648,191,9998,191,9990.00%
crit42.72%13.576231,425,249.54211,7652,693,4871,439,413.89973,8152,066,94519,334,82319,334,8230.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (50,410)0.0% (8.1%)3.790.73s4,127,6980

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 50,4108.1%382.91.20s39,3630Periodic382.939,362039,3620.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage382.850.000.00382.850.000.00000.000015,070,317.1415,070,317.140.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%382.8528545639,361.6519488,72739,398.7433,60646,18415,070,31715,070,3170.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:41779.88
  • base_dd_max:41779.88
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 62,80710.0%52.25.80s359,060357,459Direct52.2151,571494,517359,11660.5%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2152.210.000.000.001.00450.000018,744,767.6024,450,122.2723.33%357,458.53357,458.53
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit39.48%20.611330151,570.6170,819214,607151,565.03137,125169,3583,124,4214,070,54923.25%
crit60.52%31.592145494,516.81155,801724,300494,931.72451,906531,35815,620,34620,379,57423.35%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.19

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Unseen Blade 44,9537.2%57.75.19s232,7850Direct57.7198,313399,054232,76517.2%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.7257.720.000.000.000.00000.000013,435,992.1117,559,818.9523.48%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.83%47.813069198,313.35120,057291,055198,440.31182,128213,6309,480,10512,391,36923.49%
crit17.17%9.91221399,053.83240,114582,109399,445.50285,990512,4293,955,8875,168,45023.47%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 3
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.86s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.560.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.56
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.76s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.710.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5307.22s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.47
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.63.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.223.20s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.24
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 14.221.34s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.24
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.47s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.91
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1582.2156.1s0.5s277.2s99.94%100.00%572.5 (572.5)0.1

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:11.5s / 343.5s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:6.0s / 359.9s
  • uptime_min/max:99.16% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.24%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.16%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.31%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.381.8115.7s3.5s125.7s97.33%0.00%73.4 (76.2)1.3

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.1s / 334.6s
  • trigger_min/max:1.0s / 44.2s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 357.6s
  • uptime_min/max:86.38% / 99.44%

Stack Uptimes

  • alacrity_1:3.12%
  • alacrity_2:2.27%
  • alacrity_3:1.83%
  • alacrity_4:1.67%
  • alacrity_5:88.45%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.55%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.55%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows15.90.019.0s19.0s6.9s36.88%100.00%0.0 (0.0)15.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.5s
  • trigger_min/max:9.2s / 56.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 7.0s
  • uptime_min/max:32.23% / 40.85%

Stack Uptimes

  • bolstering_shadows_1:36.88%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.2s0.00%1.42%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.0s / 181.5s
  • trigger_min/max:83.0s / 181.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0135.7s114.3s4.4s1.86%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 295.5s
  • trigger_min/max:90.0s / 187.5s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.1s
  • uptime_min/max:0.00% / 7.24%

Stack Uptimes

  • cryptic_instructions_1:1.86%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.247.823.2s23.2s8.2s36.39%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 71.7s
  • trigger_min/max:8.0s / 71.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.38% / 39.19%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.53%
  • danse_macabre_3:6.63%
  • danse_macabre_4:16.43%
  • danse_macabre_5:8.76%
  • danse_macabre_6:0.02%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.673.640.9s3.7s35.5s89.85%95.58%73.6 (73.6)6.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 179.2s
  • trigger_min/max:1.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 153.9s
  • uptime_min/max:80.62% / 95.34%

Stack Uptimes

  • deeper_daggers_1:89.85%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes15.90.019.0s19.0s3.4s18.28%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.5s
  • trigger_min/max:9.2s / 56.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 6.2s
  • uptime_min/max:15.29% / 21.63%

Stack Uptimes

  • disorienting_strikes_1:12.14%
  • disorienting_strikes_2:6.13%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0128.8s111.3s4.0s1.63%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 279.2s
  • trigger_min/max:90.0s / 195.4s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 10.4s
  • uptime_min/max:0.00% / 7.06%

Stack Uptimes

  • errant_manaforge_emission_1:1.63%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.043.722.2s5.2s17.4s81.55%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 62.8s
  • trigger_min/max:1.0s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.6s
  • uptime_min/max:66.04% / 92.97%

Stack Uptimes

  • escalating_blade_1:24.81%
  • escalating_blade_2:22.15%
  • escalating_blade_3:22.61%
  • escalating_blade_4:11.98%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.091.0s91.0s14.8s18.21%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:9013.45

Trigger Details

  • interval_min/max:83.1s / 182.4s
  • trigger_min/max:83.1s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:11.53% / 20.86%

Stack Uptimes

  • ethereal_powerlink_1:18.21%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.70%0.00%14.3 (96.0)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.4s
  • trigger_min/max:1.0s / 88.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.93% / 16.95%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.78%
  • flagellation_buff_9:0.61%
  • flagellation_buff_10:0.55%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.06%
  • flagellation_buff_19:0.43%
  • flagellation_buff_20:0.37%
  • flagellation_buff_21:0.32%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.18%
  • flagellation_buff_25:0.88%
  • flagellation_buff_26:0.37%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.11%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.25%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.2s / 98.4s
  • trigger_min/max:78.2s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.38% / 16.26%

Stack Uptimes

  • flagellation_persist_26:0.00%
  • flagellation_persist_30:14.25%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6114.6s78.0s35.6s25.02%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 330.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.0s
  • uptime_min/max:0.00% / 79.83%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.02%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.7110.8s76.3s35.6s25.48%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 72.24%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.48%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.0s76.0s35.0s24.18%0.00%2.7 (2.7)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 345.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 160.8s
  • uptime_min/max:0.00% / 75.83%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.18%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.20.6111.5s76.4s35.0s25.33%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 354.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 150.0s
  • uptime_min/max:0.00% / 71.61%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.33%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form86.90.039.9s3.4s59.1s95.34%100.00%0.0 (0.0)3.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.70%
  • flawless_form_2:8.90%
  • flawless_form_3:11.86%
  • flawless_form_4:9.71%
  • flawless_form_5:2.70%
  • flawless_form_6:4.58%
  • flawless_form_7:5.90%
  • flawless_form_8:11.19%
  • flawless_form_9:18.28%
  • flawless_form_10:8.77%
  • flawless_form_11:1.39%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.17%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.284.2s71.1s17.0s11.03%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:1.8s / 305.8s
  • trigger_min/max:0.2s / 305.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 68.0s
  • uptime_min/max:0.00% / 38.38%

Stack Uptimes

  • nascent_empowerment_Crit_1:11.03%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.286.5s72.2s16.8s10.40%0.00%0.2 (0.2)1.1

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:5.2s / 306.7s
  • trigger_min/max:0.2s / 306.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 62.4s
  • uptime_min/max:0.00% / 38.50%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.40%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.290.0s75.7s17.2s11.05%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:3.8s / 330.9s
  • trigger_min/max:0.1s / 330.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.4s
  • uptime_min/max:0.00% / 39.96%

Stack Uptimes

  • nascent_empowerment_Mastery_1:11.06%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.284.4s71.2s16.8s10.75%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.4s / 343.0s
  • trigger_min/max:0.0s / 343.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 57.4s
  • uptime_min/max:0.00% / 37.28%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.76%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.7s17.09%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.6s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:8.15% / 26.33%

Stack Uptimes

  • poised_shadows_1:17.09%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.10.017.9s18.9s1.1s2.60%11.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 64.8s
  • trigger_min/max:1.0s / 64.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.5s
  • uptime_min/max:0.41% / 4.65%

Stack Uptimes

  • premeditation_1:2.60%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0130.2s113.7s4.0s1.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 288.7s
  • trigger_min/max:90.0s / 189.3s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 12.2s
  • uptime_min/max:0.00% / 7.09%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.68%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow Blades3.70.090.9s90.9s15.8s19.27%17.30%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.1s
  • trigger_min/max:90.0s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.89% / 21.89%

Stack Uptimes

  • shadow_blades_1:19.27%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.20.023.2s23.2s8.2s36.39%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 71.7s
  • trigger_min/max:8.0s / 71.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.38% / 39.19%

Stack Uptimes

  • shadow_dance_1:36.39%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques67.5136.14.4s1.5s3.5s79.02%95.34%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 48.0s
  • trigger_min/max:0.5s / 6.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.0s
  • uptime_min/max:71.71% / 85.68%

Stack Uptimes

  • shadow_techniques_1:20.55%
  • shadow_techniques_2:21.01%
  • shadow_techniques_3:9.33%
  • shadow_techniques_4:10.50%
  • shadow_techniques_5:5.99%
  • shadow_techniques_6:5.81%
  • shadow_techniques_7:2.56%
  • shadow_techniques_8:2.27%
  • shadow_techniques_9:0.51%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.2s99.32%85.72%98.6 (98.6)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.0117.0s106.0s9.9s1.19%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:7.0s / 327.4s
  • trigger_min/max:3.6s / 296.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 17.0s
  • uptime_min/max:0.00% / 9.65%

Stack Uptimes

  • storm_sewers_citrine_1:1.19%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s11.02%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 65.8s
  • trigger_min/max:3.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:9.21% / 13.58%

Stack Uptimes

  • supercharge_1_1:11.02%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.02%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.8s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.2s
  • uptime_min/max:0.42% / 4.49%

Stack Uptimes

  • supercharge_2_1:2.02%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.2s
  • uptime_min/max:0.00% / 0.75%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.843.5s21.3s24.6s61.16%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 96.8s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.0s
  • uptime_min/max:56.88% / 65.44%

Stack Uptimes

  • symbols_of_death_1:61.16%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.6s307.6s27.4s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.7s
  • trigger_min/max:300.0s / 329.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.96% / 18.09%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.82%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.4s21.3s2.9s13.74%22.38%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 65.8s
  • trigger_min/max:1.0s / 65.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.4s
  • uptime_min/max:11.12% / 16.81%

Stack Uptimes

  • the_rotten_1:10.68%
  • the_rotten_2:3.05%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.09%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.3s
  • trigger_min/max:120.0s / 136.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.42%

Stack Uptimes

  • vanish_1:0.09%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)48.527.075.06.1s0.7s66.5s
Skyfury (Off Hand)48.226.076.06.1s0.7s66.4s
Supercharger secret_technique12.48.017.023.7s9.2s92.2s
Cold Blood secret_technique3.63.04.090.7s83.0s181.5s
Supercharger rupture0.30.03.0178.7s26.4s274.9s
Supercharger coup_de_grace2.70.09.077.7s10.2s325.7s
Supercharger eviscerate13.06.021.023.0s1.0s147.5s
CP Spent During Flagellation202.0143.0248.011.2s1.0s89.4s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.01%5.02%13.21%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 3
Energy RegenEnergy1,410.563,006.6934.02%2.13378.3211.18%
Improved AmbushCombo Points52.1933.324.59%0.6418.8736.16%
PremeditationCombo Points17.1456.637.80%3.3163.3152.79%
Relentless StrikesEnergy106.574,247.8348.07%39.86117.742.70%
Shadow BladesCombo Points21.97114.1015.72%5.1917.7413.45%
Shadow TechniquesEnergy354.621,221.3513.82%3.44197.1213.90%
Shadow TechniquesCombo Points84.77238.0132.80%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points14.99104.9114.46%7.000.000.00%
BackstabCombo Points74.6974.3610.25%1.000.330.44%
ShadowstrikeCombo Points52.19104.3614.38%2.000.030.03%
Symbols of DeathEnergy14.24361.434.09%25.38208.2336.55%
Usage Type Count Total Tot% Avg RPE APR
Combo 3
BackstabEnergy74.692,987.5233.60%40.0040.001,597.17
Coup de GraceEnergy13.21462.275.20%35.0035.0037,040.79
Coup de GraceCombo Points13.2190.2012.50%6.836.83189,832.64
EviscerateEnergy67.942,377.8526.74%35.0035.0020,729.39
EviscerateCombo Points67.94462.6264.08%6.816.81106,548.77
RuptureEnergy9.51237.682.67%25.0025.0065,152.98
RuptureCombo Points9.5165.059.01%6.846.84238,042.48
Secret TechniqueEnergy15.92477.615.37%30.0030.0077,535.57
Secret TechniqueCombo Points15.92104.0214.41%6.536.53356,021.43
ShadowstrikeEnergy52.192,348.7126.41%45.0044.997,980.88
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.5329.72901.145.70.3100.0
Combo Points0.02.432.41100.23.80.07.0

Statistics & Data Analysis

Fight Length
Combo 3 Fight Length
Count 1321
Mean 299.24
Minimum 240.10
Maximum 359.93
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Combo 3 Damage Per Second
Count 1321
Mean 626386.96
Minimum 554638.21
Maximum 699070.31
Spread ( max - min ) 144432.11
Range [ ( max - min ) / 2 * 100% ] 11.53%
Standard Deviation 22584.5922
5th Percentile 590328.48
95th Percentile 663568.53
( 95th Percentile - 5th Percentile ) 73240.05
Mean Distribution
Standard Deviation 621.3851
95.00% Confidence Interval ( 625169.06 - 627604.85 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4994
0.1 Scale Factor Error with Delta=300 4354199
0.05 Scale Factor Error with Delta=300 17416793
0.01 Scale Factor Error with Delta=300 435419802
Priority Target DPS
Combo 3 Priority Target Damage Per Second
Count 1321
Mean 626386.96
Minimum 554638.21
Maximum 699070.31
Spread ( max - min ) 144432.11
Range [ ( max - min ) / 2 * 100% ] 11.53%
Standard Deviation 22584.5922
5th Percentile 590328.48
95th Percentile 663568.53
( 95th Percentile - 5th Percentile ) 73240.05
Mean Distribution
Standard Deviation 621.3851
95.00% Confidence Interval ( 625169.06 - 627604.85 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4994
0.1 Scale Factor Error with Delta=300 4354199
0.05 Scale Factor Error with Delta=300 17416793
0.01 Scale Factor Error with Delta=300 435419802
DPS(e)
Combo 3 Damage Per Second (Effective)
Count 1321
Mean 626386.96
Minimum 554638.21
Maximum 699070.31
Spread ( max - min ) 144432.11
Range [ ( max - min ) / 2 * 100% ] 11.53%
Damage
Combo 3 Damage
Count 1321
Mean 187181164.88
Minimum 146358695.58
Maximum 224005076.81
Spread ( max - min ) 77646381.24
Range [ ( max - min ) / 2 * 100% ] 20.74%
DTPS
Combo 3 Damage Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 3 Healing Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 3 Healing Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 3 Heal
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 3 Healing Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.19 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 74.69 backstab
actions.cds
# count action,conditions
F 3.56 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.47 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.24 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.72 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.92 secret_technique,if=variable.secret
L 9.51 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.21 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 67.94 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.69 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.24 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.91 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDMNDHNDFKNENNEMENELHQDKDNDNDNENEENHQDNKDMDNDEENEMHQDNKDNDNDLEENEENEEMEEENEOEJHQPKDNINDNDNELNQDFHKNDMNDNNEENEEELRDMEHQKDNDNDNDNEEMEKEEENEEELEEMEEENEEEONEEJHQPKDINNDNDMELHQNDFKNDNDNNEENHQDNDKDMDNEEELENEENEHQKDNDDMDNENEENEKRDNEELEEEMEEENEEOJHQPKDINDNNDNLHQDNDFKNDMNENNEEEENHQDKNDDMDNGENEELENEENEEHQKDNDNDMDENEE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, cryptic_instructions
0:01.002Gpotion
[cds]
Fluffy_Pillow 72.2/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, cryptic_instructions
0:01.002Jflagellation
[cds]
Fluffy_Pillow 72.2/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, cryptic_instructions, tempered_potion
0:02.005Neviscerate
[finish]
Fluffy_Pillow 90.0/100 90% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(5), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff, cryptic_instructions, tempered_potion
0:03.012Rvanish
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:03.012Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(8), alacrity, flawless_form, premeditation, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:04.016Lrupture
[finish]
Fluffy_Pillow 68.9/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, cryptic_instructions, tempered_potion
0:05.020Hsymbols_of_death
[cds]
Combo 3 97.0/100 97% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(15), deeper_daggers, cryptic_instructions, tempered_potion
0:05.020Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, tempered_potion
0:05.020Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, cryptic_instructions, tempered_potion
0:05.020Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.023Ishadow_blades
[cds]
Combo 3 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.023Ksecret_technique
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.028Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(3), shadow_techniques(8), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.032Neviscerate
[finish]
Fluffy_Pillow 77.2/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(4), shadow_techniques(10), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.036Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(4), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.041Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.046Mcoup_de_grace
[finish]
Fluffy_Pillow 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.253Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.258Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.262Hsymbols_of_death
[cds]
Combo 3 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.262Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.267Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.272Fcold_blood
[cds]
Combo 3 85.5/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(11), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.272Ksecret_technique
[finish]
Fluffy_Pillow 85.5/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(11), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.277Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(11), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:18.280Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(10), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:19.285Neviscerate
[finish]
Fluffy_Pillow 82.5/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:20.288Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:21.292Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:22.296Mcoup_de_grace
[finish]
Fluffy_Pillow 82.5/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:23.499Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, tempered_potion
0:24.504Neviscerate
[finish]
Fluffy_Pillow 90.5/100 90% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, tempered_potion
0:25.509Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, tempered_potion
0:26.511Lrupture
[finish]
Fluffy_Pillow 82.4/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, tempered_potion
0:27.515Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, tempered_potion
0:27.515Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, tempered_potion
0:27.515Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, tempered_potion
0:28.520Ksecret_technique
[finish]
Fluffy_Pillow 69.5/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, tempered_potion
0:29.524Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:30.530Neviscerate
[finish]
Fluffy_Pillow 77.5/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:31.537Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:32.540Neviscerate
[finish]
Fluffy_Pillow 76.9/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:33.544Dshadowstrike
[build]
Fluffy_Pillow 98.8/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:34.547Neviscerate
[finish]
Fluffy_Pillow 75.7/100 76% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:35.551Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, nascent_empowerment_Mastery
0:36.556Neviscerate
[finish]
Fluffy_Pillow 81.9/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery
0:37.562Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery
0:38.566Ebackstab
[build]
Fluffy_Pillow 81.9/100 82% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery
0:39.570Neviscerate
[finish]
Fluffy_Pillow 71.8/100 72% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, nascent_empowerment_Mastery
0:40.573Hsymbols_of_death
[cds]
Combo 3 91.9/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), deeper_daggers, nascent_empowerment_Mastery
0:40.573Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(7), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery
0:40.573Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(7), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery
0:41.577Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery
0:42.580Ksecret_technique
[finish]
Fluffy_Pillow 99.4/100 99% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery
0:43.585Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery
0:44.589Mcoup_de_grace
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:45.793Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows
0:46.797Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, bolstering_shadows
0:47.803Dshadowstrike
[build]
Fluffy_Pillow 76.4/100 76% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, bolstering_shadows
0:48.807Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, bolstering_shadows
0:50.983Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers
0:53.233Neviscerate
[finish]
Fluffy_Pillow 41.4/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), deeper_daggers
0:54.237Ebackstab
[build]
Fluffy_Pillow 60.1/100 60% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(8), deeper_daggers
0:55.240Mcoup_de_grace
[finish]
Fluffy_Pillow 38.8/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(4), deeper_daggers
0:56.443Hsymbols_of_death
[cds]
Combo 3 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(14), shadow_techniques(6), deeper_daggers
0:56.443Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(14), shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows
0:56.443Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(14), premeditation, shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows
0:57.448Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:58.454Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(3), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:59.458Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:00.463Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:01.467Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:02.472Neviscerate
[finish]
Fluffy_Pillow 58.1/100 58% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:03.476Dshadowstrike
[build]
Fluffy_Pillow 71.9/100 72% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:04.482Lrupture
[finish]
Fluffy_Pillow 45.6/100 46% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:05.487Ebackstab
[build]
Fluffy_Pillow 66.3/100 66% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
1:06.892Ebackstab
[build]
Fluffy_Pillow 49.3/100 49% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
1:08.432Neviscerate
[finish]
Fluffy_Pillow 41.7/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
1:09.437Ebackstab
[build]
Fluffy_Pillow 47.4/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
1:11.602Ebackstab
[build]
Fluffy_Pillow 42.5/100 43% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
1:14.370Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
1:15.375Ebackstab
[build]
Fluffy_Pillow 46.8/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
1:18.020Ebackstab
[build]
Fluffy_Pillow 43.0/100 43% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
1:20.762Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
1:21.969Ebackstab
[build]
Fluffy_Pillow 78.4/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:22.974Ebackstab
[build]
Fluffy_Pillow 53.3/100 53% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:25.191Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:27.894Neviscerate
[finish]
Fluffy_Pillow 39.0/100 39% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:28.898Ebackstab
[build]
Fluffy_Pillow 49.9/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:29.901Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 20.9/100 21% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:31.417Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:32.422Jflagellation
[cds]
Fluffy_Pillow 16.5/100 16% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:33.425Hsymbols_of_death
[cds]
Combo 3 27.5/100 27% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:33.425Qshadow_dance
[stealth_cds]
Combo 3 67.5/100 67% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:33.425Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 67.5/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:33.425Ksecret_technique
[finish]
Fluffy_Pillow 67.5/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:34.432Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:35.435Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(7), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:36.438Ishadow_blades
[cds]
Combo 3 99.9/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:36.438Neviscerate
[finish]
Fluffy_Pillow 99.9/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:37.442Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), the_rotten, flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:38.446Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:39.451Dshadowstrike
[build]
Fluffy_Pillow 85.0/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:40.457Neviscerate
[finish]
Fluffy_Pillow 59.0/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:41.460Ebackstab
[build]
Fluffy_Pillow 78.0/100 78% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:42.465Lrupture
[finish]
Fluffy_Pillow 56.9/100 57% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(10), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:43.469Neviscerate
[finish]
Fluffy_Pillow 85.9/100 86% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:44.475Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(9), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:44.475Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(9), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:45.482Fcold_blood
[cds]
Combo 3 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(11), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:45.482Hsymbols_of_death
[cds]
Combo 3 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(3), flawless_form(2), shadow_techniques(11), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:45.482Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(11), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:46.488Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:47.493Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(8), the_rotten(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:48.498Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:49.703Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:50.707Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:51.711Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:52.714Neviscerate
[finish]
Fluffy_Pillow 92.5/100 93% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
1:53.719Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
1:54.726Ebackstab
[build]
Fluffy_Pillow 70.8/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
1:55.729Neviscerate
[finish]
Fluffy_Pillow 41.5/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
1:56.734Ebackstab
[build]
Fluffy_Pillow 47.3/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_vers
1:59.081Ebackstab
[build]
Fluffy_Pillow 44.3/100 44% energy
1.0/7 14% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
2:02.095Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:04.966Lrupture
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, flask_of_alchemical_chaos_vers
2:05.970Rvanish
[stealth_cds]
Combo 3 55.8/100 56% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, flask_of_alchemical_chaos_vers
2:05.970Dshadowstrike
[build]
Fluffy_Pillow 55.8/100 56% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, premeditation, shadow_techniques, flask_of_alchemical_chaos_vers
2:07.992Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_vers
2:09.196Ebackstab
[build]
Fluffy_Pillow 78.2/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
2:10.200Hsymbols_of_death
[cds]
Combo 3 48.9/100 49% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), deeper_daggers, flask_of_alchemical_chaos_vers
2:10.200Qshadow_dance
[stealth_cds]
Combo 3 88.9/100 89% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:10.200Ksecret_technique
[finish]
Fluffy_Pillow 88.9/100 89% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), premeditation, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:11.203Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
2:12.209Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:13.214Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:14.218Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:15.222Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:16.227Neviscerate
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:17.231Dshadowstrike
[build]
Fluffy_Pillow 76.8/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:18.235Neviscerate
[finish]
Fluffy_Pillow 42.6/100 43% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:19.239Ebackstab
[build]
Fluffy_Pillow 61.3/100 61% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:20.242Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:22.206Mcoup_de_grace
[finish]
Fluffy_Pillow 37.6/100 38% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:23.409Ebackstab
[build]
Fluffy_Pillow 78.7/100 79% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:24.412Ksecret_technique
[finish]
Fluffy_Pillow 49.6/100 50% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:25.417Ebackstab
[build]
Fluffy_Pillow 69.5/100 70% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:26.421Ebackstab
[build]
Fluffy_Pillow 44.5/100 44% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:28.917Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:31.637Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:32.641Ebackstab
[build]
Fluffy_Pillow 51.4/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:34.947Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:37.733Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:39.586Lrupture
[finish]
Fluffy_Pillow 25.7/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:40.591Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(3), nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:42.845Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:45.711Mcoup_de_grace
[finish]
Fluffy_Pillow 36.8/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:46.916Ebackstab
[build]
Fluffy_Pillow 74.4/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:47.922Ebackstab
[build]
Fluffy_Pillow 49.7/100 50% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:50.265Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:52.710Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:53.715Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:56.305Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:59.605Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:00.611Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 16.8/100 17% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:01.994Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), cryptic_instructions, flask_of_alchemical_chaos_haste
3:02.998Ebackstab
[build]
Fluffy_Pillow 47.7/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
3:05.106Ebackstab
[build]
Fluffy_Pillow 43.5/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(3), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
3:06.110Jflagellation
[cds]
Fluffy_Pillow 14.8/100 15% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
3:07.116Hsymbols_of_death
[cds]
Combo 3 30.1/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, flagellation_buff, deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_haste
3:07.116Qshadow_dance
[stealth_cds]
Combo 3 70.1/100 70% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
3:07.116Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 70.1/100 70% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, flask_of_alchemical_chaos_haste
3:07.116Ksecret_technique
[finish]
Fluffy_Pillow 70.1/100 70% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:08.121Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:09.123Ishadow_blades
[cds]
Combo 3 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(11), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:09.123Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(11), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:10.125Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), the_rotten, flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:11.130Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(2), the_rotten, flagellation_buff(28), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:12.135Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(28), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:13.140Dshadowstrike
[build]
Fluffy_Pillow 93.7/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:14.143Mcoup_de_grace
[finish]
Fluffy_Pillow 60.0/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:15.346Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(10), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:16.351Lrupture
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(10), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:17.355Hsymbols_of_death
[cds]
Combo 3 92.7/100 93% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:17.355Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:17.355Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:18.360Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:19.365Fcold_blood
[cds]
Combo 3 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:19.365Ksecret_technique
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:20.371Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:21.375Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:22.380Neviscerate
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:23.384Dshadowstrike
[build]
Fluffy_Pillow 85.7/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:24.389Neviscerate
[finish]
Fluffy_Pillow 60.0/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:25.394Neviscerate
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:26.398Ebackstab
[build]
Fluffy_Pillow 90.6/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:27.402Ebackstab
[build]
Fluffy_Pillow 69.6/100 70% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
3:28.408Neviscerate
[finish]
Fluffy_Pillow 48.3/100 48% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
3:29.412Hsymbols_of_death
[cds]
Combo 3 59.1/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
3:29.412Qshadow_dance
[stealth_cds]
Combo 3 99.1/100 99% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:29.412Dshadowstrike
[build]
Fluffy_Pillow 99.1/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:30.417Neviscerate
[finish]
Fluffy_Pillow 72.9/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:31.422Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:32.426Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:33.428Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:34.432Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:35.639Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:36.644Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:37.650Ebackstab
[build]
Fluffy_Pillow 76.5/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:38.656Ebackstab
[build]
Fluffy_Pillow 55.3/100 55% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:39.763Ebackstab
[build]
Fluffy_Pillow 43.2/100 43% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:41.339Lrupture
[finish]
Fluffy_Pillow 28.1/100 28% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:42.342Ebackstab
[build]
Fluffy_Pillow 56.8/100 57% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:43.345Neviscerate
[finish]
Fluffy_Pillow 35.6/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:44.350Ebackstab
[build]
Fluffy_Pillow 46.3/100 46% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:46.056Ebackstab
[build]
Fluffy_Pillow 48.6/100 49% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(6), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:48.269Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:49.272Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:50.277Hsymbols_of_death
[cds]
Combo 3 21.8/100 22% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:50.277Qshadow_dance
[stealth_cds]
Combo 3 61.8/100 62% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:50.277Ksecret_technique
[finish]
Fluffy_Pillow 61.8/100 62% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:51.280Dshadowstrike
[build]
Fluffy_Pillow 95.6/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:52.284Neviscerate
[finish]
Fluffy_Pillow 61.3/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:53.287Dshadowstrike
[build]
Fluffy_Pillow 87.3/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:54.291Dshadowstrike
[build]
Fluffy_Pillow 61.3/100 61% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:55.295Mcoup_de_grace
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:56.500Dshadowstrike
[build]
Fluffy_Pillow 81.4/100 81% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:57.504Neviscerate
[finish]
Fluffy_Pillow 55.9/100 56% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:58.507Ebackstab
[build]
Fluffy_Pillow 83.4/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(8), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:59.513Neviscerate
[finish]
Fluffy_Pillow 63.0/100 63% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:00.518Ebackstab
[build]
Fluffy_Pillow 74.5/100 75% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:01.522Ebackstab
[build]
Fluffy_Pillow 54.1/100 54% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:02.759Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:03.763Ebackstab
[build]
Fluffy_Pillow 55.8/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:04.766Ksecret_technique
[finish]
Fluffy_Pillow 35.4/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:05.771Rvanish
[stealth_cds]
Combo 3 50.9/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:05.970Dshadowstrike
[build]
Fluffy_Pillow 53.2/100 53% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), premeditation, shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:08.219Neviscerate
[finish]
Fluffy_Pillow 38.1/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:09.223Ebackstab
[build]
Fluffy_Pillow 49.6/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:11.535Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:13.623Lrupture
[finish]
Fluffy_Pillow 27.9/100 28% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
4:14.627Ebackstab
[build]
Fluffy_Pillow 49.3/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
4:17.102Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_haste
4:19.923Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, flask_of_alchemical_chaos_haste
4:23.077Mcoup_de_grace
[finish]
Fluffy_Pillow 40.5/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, flask_of_alchemical_chaos_haste
4:24.281Ebackstab
[build]
Fluffy_Pillow 79.1/100 79% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
4:25.286Ebackstab
[build]
Fluffy_Pillow 50.5/100 50% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), deeper_daggers, flask_of_alchemical_chaos_haste
4:27.600Ebackstab
[build]
Fluffy_Pillow 44.5/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
4:30.085Neviscerate
[finish]
Fluffy_Pillow 36.6/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
4:31.090Ebackstab
[build]
Fluffy_Pillow 46.9/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
4:33.587Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
4:34.591Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 14.4/100 14% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), deeper_daggers, flask_of_alchemical_chaos_haste
4:36.017Jflagellation
[cds]
Fluffy_Pillow 34.5/100 34% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:37.115Hsymbols_of_death
[cds]
Combo 3 46.8/100 47% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:37.115Qshadow_dance
[stealth_cds]
Combo 3 86.8/100 87% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:37.115Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 86.8/100 87% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:37.115Ksecret_technique
[finish]
Fluffy_Pillow 86.8/100 87% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:38.121Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(10), poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:39.126Ishadow_blades
[cds]
Combo 3 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:39.126Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:40.129Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:41.132Neviscerate
[finish]
Fluffy_Pillow 82.5/100 83% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(9), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:42.137Neviscerate
[finish]
Fluffy_Pillow 94.1/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:43.141Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:44.146Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:45.150Lrupture
[finish]
Fluffy_Pillow 86.1/100 86% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:46.154Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:46.154Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:46.154Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:47.159Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:48.164Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:49.168Fcold_blood
[cds]
Combo 3 66.5/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:49.168Ksecret_technique
[finish]
Fluffy_Pillow 66.5/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:50.174Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:51.178Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:52.183Mcoup_de_grace
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:53.387Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:54.391Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:55.395Neviscerate
[finish]
Fluffy_Pillow 79.5/100 80% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:56.401Neviscerate
[finish]
Fluffy_Pillow 91.1/100 91% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:57.405Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:58.410Ebackstab
[build]
Fluffy_Pillow 71.0/100 71% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:59.414Ebackstab
[build]
Fluffy_Pillow 42.0/100 42% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:01.540Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:04.309Neviscerate
[finish]
Fluffy_Pillow 35.5/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:05.314Hsymbols_of_death
[cds]
Combo 3 50.5/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:05.314Qshadow_dance
[stealth_cds]
Combo 3 90.5/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:05.314Dshadowstrike
[build]
Fluffy_Pillow 90.5/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:06.319Ksecret_technique
[finish]
Fluffy_Pillow 64.5/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:07.325Neviscerate
[finish]
Fluffy_Pillow 95.5/100 96% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:08.330Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:09.335Dshadowstrike
[build]
Fluffy_Pillow 74.0/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:10.339Mcoup_de_grace
[finish]
Fluffy_Pillow 48.0/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:11.545Dshadowstrike
[build]
Fluffy_Pillow 94.2/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:12.550Neviscerate
[finish]
Fluffy_Pillow 68.2/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:13.555Gpotion
[cds]
Fluffy_Pillow 87.2/100 87% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:13.555Ebackstab
[build]
Fluffy_Pillow 87.2/100 87% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, tempered_potion
5:14.559Neviscerate
[finish]
Fluffy_Pillow 66.6/100 67% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit, tempered_potion
5:15.563Ebackstab
[build]
Fluffy_Pillow 85.9/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:16.568Ebackstab
[build]
Fluffy_Pillow 65.1/100 65% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:17.574Lrupture
[finish]
Fluffy_Pillow 44.3/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:18.579Ebackstab
[build]
Fluffy_Pillow 73.5/100 73% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:19.583Neviscerate
[finish]
Fluffy_Pillow 52.6/100 53% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:20.588Ebackstab
[build]
Fluffy_Pillow 62.8/100 63% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:22.162Ebackstab
[build]
Fluffy_Pillow 44.4/100 44% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:24.625Neviscerate
[finish]
Fluffy_Pillow 35.8/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:25.628Ebackstab
[build]
Fluffy_Pillow 46.0/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
5:28.041Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:30.098Hsymbols_of_death
[cds]
Combo 3 25.7/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:30.098Qshadow_dance
[stealth_cds]
Combo 3 65.7/100 66% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:30.098Ksecret_technique
[finish]
Fluffy_Pillow 65.7/100 66% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:31.101Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:32.106Neviscerate
[finish]
Fluffy_Pillow 74.8/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:33.109Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:34.115Neviscerate
[finish]
Fluffy_Pillow 74.8/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:35.118Dshadowstrike
[build]
Fluffy_Pillow 94.5/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste, tempered_potion
5:36.123Mcoup_de_grace
[finish]
Fluffy_Pillow 61.3/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste, tempered_potion
5:37.329Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste, tempered_potion
5:38.333Ebackstab
[build]
Fluffy_Pillow 74.7/100 75% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste, tempered_potion
5:39.338Neviscerate
[finish]
Fluffy_Pillow 54.5/100 55% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste, tempered_potion
5:40.342Ebackstab
[build]
Fluffy_Pillow 61.3/100 61% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste, tempered_potion
5:41.348Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470361443490715598 (13526)
Stamina86452018645517757791125
Intellect12000012360120000
Spirit00000
Health372910035515400
Energy1001000
Combo Points770
Spell Power12360120000
Crit15.01%15.44%2405
Haste7.39%2.02%1336
Versatility10.62%7.99%6236
Attack Power3893635845938
Mastery38.07%33.17%3877
Armor166061660616606
Run Speed800
Leech3.00%3.00%0

Gear

Source Slot Average Item Level: 560.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 437, stats: { 648 Armor, +2,008 Sta, +532 Vers, +314 Mastery, +578 AgiInt }
Local Neck Silken Advisor's Favor
ilevel: 571, stats: { +5,034 Sta, +2,689 Vers, +556 Mastery }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 571, stats: { 2,099 Armor, +6,712 Sta, +685 Vers, +366 Mastery, +1,510 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 571, stats: { 3,053 Armor, +8,949 Sta, +451 Crit, +949 Vers, +2,014 AgiInt }
Local Waist Devourer's Taut Innards
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +731 Vers, +319 Mastery, +1,510 AgiInt }
Local Legs K'areshi Phantom's Leggings
ilevel: 571, stats: { 2,671 Armor, +8,949 Sta, +418 Crit, +983 Mastery, +2,014 AgiInt }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 571, stats: { 1,908 Armor, +6,712 Sta, +328 Vers, +723 Mastery, +1,510 AgiInt }
Local Wrists Rune-Branded Armbands
ilevel: 577, stats: { 1,571 Armor, +5,483 Sta, +797 unknown(24), +797 unknown(25), +1,198 AgiInt }
Local Hands K'areshi Phantom's Grips
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +741 Crit, +309 Haste, +1,510 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 619, stats: { +10,359 Sta }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Ring of Earthen Craftsmanship
ilevel: 610, stats: { +9,112 Sta, +2,710 unknown(24), +2,710 unknown(25) }
Local Trinket1 Treacherous Transmitter
ilevel: 571, stats: { +1,001 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 437, stats: { +549 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 571, stats: { 1,222 Armor, +5,034 Sta, +248 Crit, +540 Mastery, +1,133 StrAgiInt }
Local Main Hand Blood-Kissed Kukri
ilevel: 571, weapon: { 1,545 - 2,576, 1.8 }, stats: { +1,007 Agi, +4,475 Sta, +500 Crit, +200 Vers }, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 577, weapon: { 1,633 - 2,724, 1.8 }, stats: { +1,065 Agi, +4,874 Sta, +709 unknown(24), +709 unknown(25) }, temporary_enchant: Ironclaw Sharpened Weapon

Profile

rogue="Combo 3"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824
neck=silken_advisors_favor,id=225575
shoulders=kareshi_phantoms_shoulderpads,id=212036
back=royal_emblem_of_nerubar,id=212446
chest=kareshi_phantoms_nexus_wraps,id=212041
wrists=runebranded_armbands,id=219334
hands=kareshi_phantoms_grips,id=212039
waist=devourers_taut_innards,id=212425
legs=kareshi_phantoms_leggings,id=212037
feet=kareshi_phantoms_netherwalkers,id=212040
finger1=cyrces_circlet,id=228411
finger2=ring_of_earthen_craftsmanship,id=215135
trinket1=treacherous_transmitter,id=221023
trinket2=empowering_crystal_of_anubikkaj,id=219312
main_hand=bloodkissed_kukri,id=212395
off_hand=everforged_stabber,id=222438

# Gear Summary
# gear_ilvl=560.44
# gear_agility=15598
# gear_stamina=91125
# gear_attack_power=938
# gear_crit_rating=2358
# gear_haste_rating=1310
# gear_mastery_rating=3801
# gear_versatility_rating=6114
# gear_armor=16606
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 4 : 628,929 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
628,928.6628,928.61,225.7 / 0.195%88,087.3 / 14.0%21,128.5
Resource Out In Waiting APM Active
Energy29.729.512.25%56.9100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 4628,929
Auto Attack 0 (36,858)0.0% (5.9%)3.9122.43s2,816,7730

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 24,5033.9%349.01.00s20,98921,194Direct349.020,75041,78820,99217.3%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage349.02349.020.000.000.000.99030.00007,325,605.109,562,177.5023.39%21,194.4421,194.44
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.26%231.2516830920,749.8512,41833,10720,758.1219,66721,9034,798,2256,263,73623.40%
crit17.33%60.49329941,788.0925,58166,21341,812.7837,50046,2302,527,3803,298,44123.38%
miss16.41%57.2833860.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 12,3552.0%348.71.00s10,59310,659Direct348.710,48321,07710,59317.2%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage348.73348.730.000.000.000.99380.00003,694,139.054,822,073.2023.39%10,659.4210,659.42
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.43%231.6816930810,482.936,32716,67510,487.4910,04810,9852,428,7083,170,54623.40%
crit17.22%60.04319821,076.5812,52933,35021,091.9819,03423,7331,265,4321,651,52723.38%
miss16.35%57.0132910.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 15,9762.5%74.73.70s64,12063,833Direct74.739,442102,34464,10039.2%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.7074.700.000.000.001.00450.00004,789,875.706,271,727.1923.63%63,832.6763,832.67
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.78%45.40276839,442.3531,15681,69839,443.0237,14142,3761,790,7732,345,91123.65%
crit39.22%29.301349102,344.0668,543217,974102,369.2493,271115,9962,999,1033,925,81623.62%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:74.70

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 40,432 (57,699)6.4% (9.2%)13.222.52s1,305,4631,083,863Direct39.6 (77.5)239,773480,644305,51727.3% (27.2%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2139.560.000.000.001.20450.000012,079,994.9215,729,281.1323.20%1,083,862.601,083,862.60
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.73%28.771743239,772.7653,830874,006240,060.31141,967361,6016,898,7438,982,62123.20%
crit27.27%10.79221480,644.15108,7271,751,362480,966.54212,749884,9075,181,2526,746,66023.21%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.20
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 17,2672.7%0.00.00s00Direct37.9106,658214,819136,04027.2%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0037.910.000.000.000.00000.00005,158,839.715,158,839.710.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.78%27.591544106,657.8024,683379,902106,763.2873,158157,3202,941,3222,941,3220.00%
crit27.22%10.32022214,819.0151,835758,350215,140.340376,8092,217,5182,217,5180.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Eviscerate 116,128 (166,085)18.5% (26.4%)68.04.40s729,705726,445Direct68.0 (134.5)397,572813,783510,39627.1% (27.0%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.9967.990.000.000.001.00450.000034,687,931.6145,126,194.7323.13%726,445.27726,445.27
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.91%49.573068397,571.8295,7311,079,584397,497.05331,185472,86819,700,94225,631,11623.14%
crit27.09%18.42533813,783.22191,4632,164,244814,159.01502,5101,126,37814,986,99019,495,07923.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.00

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 49,9577.9%66.54.50s224,3690Direct66.5174,686359,880224,42026.9%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.5266.520.000.000.000.00000.000014,925,374.3914,925,374.390.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.14%48.653165174,685.6945,639469,463174,693.66135,879209,5538,495,5728,495,5720.00%
crit26.86%17.87634359,880.1391,278931,852360,680.09174,476526,3326,429,8036,429,8030.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 553 (11,131)0.1% (1.8%)3.791.41s897,649893,743Direct3.7 (27.5)37,81175,56544,49717.7% (17.9%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000165,033.43165,033.430.00%893,743.22893,743.22
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.26%3.050437,810.5033,22072,10237,753.11057,388115,328115,3280.00%
crit17.74%0.660475,565.1366,440144,20338,826.500144,20349,70549,7050.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.71
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 10,5791.7%0.00.00s00Direct23.8113,214223,996133,02217.9%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.780.000.000.000.00000.00003,163,266.313,163,266.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.09%19.52928113,214.0542,206239,373113,169.8395,471128,9332,209,9552,209,9550.00%
crit17.91%4.26012223,996.0386,824471,553221,453.030436,215953,311953,3110.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 6,4281.0%0.00.00s00Direct279.85,84011,7526,86917.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00279.770.000.000.000.00000.00001,921,527.501,921,527.500.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.60%231.081543075,839.664,0979,0375,841.685,5126,2061,349,3281,349,3280.00%
crit17.40%48.69228411,751.528,19418,07311,755.5610,38813,207572,200572,2000.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 43,987 (52,076)7.0% (8.3%)9.531.18s1,636,2291,628,908Periodic164.8 (329.6)62,285128,78979,80426.3% (26.3%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.510.00164.79164.796.981.00451.763813,148,328.0713,148,328.070.00%51,849.001,628,908.21
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.66%121.397616062,284.7550191,88662,332.3354,72571,2967,561,0157,561,0150.00%
crit26.34%43.402470128,789.37236377,032128,960.6799,133168,1985,587,3135,587,3130.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.51
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 8,0881.3%164.81.78s14,6700Periodic164.811,43423,77214,67426.2%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage164.790.000.00164.790.000.00000.00002,417,518.782,417,518.780.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.75%121.548515711,433.774,39135,18411,441.3710,17612,8271,389,5571,389,5570.00%
crit26.25%43.25226723,771.918,78170,00123,809.3517,58232,9571,027,9621,027,9620.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (124,282)0.0% (19.8%)15.919.08s2,331,2132,320,823

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.940.000.000.000.001.00450.00000.000.000.00%2,320,822.912,320,822.91

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.94
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 31,8985.1%0.00.00s00Direct15.9312,290994,796598,49641.9%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.940.000.000.000.00000.00009,536,391.6412,434,882.8023.31%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.07%9.25315312,290.2668,613747,373312,979.53203,155431,2602,890,0723,780,83923.56%
crit41.93%6.68313994,795.99136,7591,847,1771,015,409.94647,8371,549,7986,646,3208,654,04423.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 92,38414.7%0.00.00s00Direct31.8454,2681,425,683869,24942.7%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.770.000.000.000.00000.000027,613,020.6827,613,020.680.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.31%18.21928454,267.92100,6161,080,789454,734.89340,918593,2858,269,9938,269,9930.00%
crit42.69%13.567231,425,683.35210,1492,671,2381,440,484.49897,2882,111,95919,343,02819,343,0280.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (50,411)0.0% (8.0%)3.690.91s4,132,9980

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 50,4118.0%382.41.20s39,4160Periodic382.439,414039,4140.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage382.360.000.00382.360.000.00000.000015,070,894.5515,070,894.550.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%382.3628546239,414.3118490,85139,456.2332,81647,21615,070,89515,070,8950.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2398.06
  • base_dd_max:2398.06
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 62,96210.0%52.25.82s359,856358,245Direct52.2152,216495,639359,92360.5%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2152.210.000.000.001.00450.000018,788,537.5224,507,617.5323.34%358,245.39358,245.39
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit39.53%20.641133152,216.5071,026215,186152,231.63137,581169,4993,141,0844,092,44523.25%
crit60.47%31.572244495,638.73156,258726,252496,079.60449,459532,23715,647,45420,415,17223.35%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.21

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Unseen Blade 45,0207.2%57.75.22s233,2410Direct57.7199,019399,365233,26117.1%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.7057.700.000.000.000.00000.000013,458,966.6317,590,621.6123.49%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.91%47.843268199,018.54120,409291,839199,143.31184,024217,3019,520,87612,444,29323.49%
crit17.09%9.86122399,365.25240,818583,679399,948.82288,142510,4753,938,0915,146,32923.48%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 4
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.77s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.560.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.18s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.720.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5307.18s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.47
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.63.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.223.21s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.25
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 14.221.32s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.25
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.43s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 4
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.91
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1582.4171.4s0.5s277.6s99.94%100.00%572.7 (572.7)0.1

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.2s / 326.8s
  • trigger_min/max:0.0s / 4.6s
  • trigger_pct:100.00%
  • duration_min/max:2.6s / 359.9s
  • uptime_min/max:99.16% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.15%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.32%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.481.6116.7s3.5s123.3s97.23%0.00%73.0 (75.8)1.4

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 339.0s
  • trigger_min/max:1.0s / 38.1s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 356.9s
  • uptime_min/max:82.16% / 99.44%

Stack Uptimes

  • alacrity_1:3.12%
  • alacrity_2:2.40%
  • alacrity_3:1.92%
  • alacrity_4:1.70%
  • alacrity_5:88.10%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.55%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.55%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows15.90.019.0s19.0s6.9s36.90%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.1s
  • trigger_min/max:9.2s / 56.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.44% / 40.49%

Stack Uptimes

  • bolstering_shadows_1:36.90%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.42%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:81.1s / 100.4s
  • trigger_min/max:81.1s / 100.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.07%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0130.6s111.7s4.4s1.83%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.9s
  • trigger_min/max:90.0s / 253.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.3s
  • uptime_min/max:0.00% / 6.97%

Stack Uptimes

  • cryptic_instructions_1:1.83%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.247.923.2s23.2s8.2s36.40%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 72.9s
  • trigger_min/max:8.0s / 72.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.75% / 39.00%

Stack Uptimes

  • danse_macabre_1:0.03%
  • danse_macabre_2:4.53%
  • danse_macabre_3:6.57%
  • danse_macabre_4:16.50%
  • danse_macabre_5:8.75%
  • danse_macabre_6:0.02%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.773.540.1s3.7s34.8s89.91%95.61%73.5 (73.5)6.7

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 170.0s
  • trigger_min/max:1.0s / 39.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 154.0s
  • uptime_min/max:78.70% / 95.56%

Stack Uptimes

  • deeper_daggers_1:89.91%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes15.90.019.0s19.0s3.4s18.30%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.1s
  • trigger_min/max:9.2s / 56.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:15.20% / 21.29%

Stack Uptimes

  • disorienting_strikes_1:12.16%
  • disorienting_strikes_2:6.14%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0126.9s112.1s4.0s1.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 279.1s
  • trigger_min/max:90.0s / 252.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.9s
  • uptime_min/max:0.00% / 7.32%

Stack Uptimes

  • errant_manaforge_emission_1:1.67%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.043.722.2s5.2s17.4s81.71%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 63.6s
  • trigger_min/max:1.0s / 25.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.1s
  • uptime_min/max:63.94% / 94.06%

Stack Uptimes

  • escalating_blade_1:25.05%
  • escalating_blade_2:22.25%
  • escalating_blade_3:22.52%
  • escalating_blade_4:11.88%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.8s18.25%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:9013.45

Trigger Details

  • interval_min/max:82.1s / 182.2s
  • trigger_min/max:82.1s / 182.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:12.82% / 20.88%

Stack Uptimes

  • ethereal_powerlink_1:18.25%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.723.991.3s9.7s11.9s14.70%0.00%14.2 (95.5)3.6

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.5s
  • trigger_min/max:1.0s / 87.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.94% / 16.91%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.62%
  • flagellation_buff_10:0.53%
  • flagellation_buff_11:0.48%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.06%
  • flagellation_buff_19:0.43%
  • flagellation_buff_20:0.37%
  • flagellation_buff_21:0.32%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.21%
  • flagellation_buff_25:0.85%
  • flagellation_buff_26:0.39%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.21%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.09%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.27%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.0s / 98.5s
  • trigger_min/max:78.0s / 98.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s
  • uptime_min/max:12.34% / 16.24%

Stack Uptimes

  • flagellation_persist_1:0.00%
  • flagellation_persist_23:0.00%
  • flagellation_persist_30:14.26%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6111.3s76.3s35.2s24.96%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 327.7s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 83.03%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.96%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.7112.9s74.4s35.9s25.07%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.0s / 336.5s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 210.0s
  • uptime_min/max:0.00% / 74.80%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.07%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6110.9s76.3s35.4s25.14%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 331.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 70.90%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.14%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.8s77.4s35.2s24.83%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 340.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 185.8s
  • uptime_min/max:0.00% / 77.24%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.83%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form86.80.040.4s3.4s59.5s95.34%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.76%
  • flawless_form_2:8.89%
  • flawless_form_3:11.85%
  • flawless_form_4:9.63%
  • flawless_form_5:2.70%
  • flawless_form_6:4.48%
  • flawless_form_7:5.95%
  • flawless_form_8:11.20%
  • flawless_form_9:18.47%
  • flawless_form_10:8.71%
  • flawless_form_11:1.38%
  • flawless_form_12:0.06%
  • flawless_form_13:0.00%
  • flawless_form_14:0.01%
  • flawless_form_15:0.15%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.284.7s72.4s16.8s10.76%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.7s / 326.2s
  • trigger_min/max:0.2s / 326.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.5s
  • uptime_min/max:0.00% / 37.71%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.76%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.7s75.2s16.8s10.89%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:4.2s / 318.0s
  • trigger_min/max:0.3s / 318.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 52.3s
  • uptime_min/max:0.00% / 37.98%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.90%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.287.0s72.7s17.0s10.82%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.5s / 335.0s
  • trigger_min/max:0.2s / 335.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 55.4s
  • uptime_min/max:0.00% / 41.40%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.82%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)2.00.283.0s70.7s16.8s10.93%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:3.4s / 317.4s
  • trigger_min/max:0.1s / 317.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 73.0s
  • uptime_min/max:0.00% / 43.52%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.93%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.522.1s21.3s3.8s17.33%100.00%0.5 (0.5)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.6s
  • trigger_min/max:1.0s / 69.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 27.9s
  • uptime_min/max:9.44% / 27.38%

Stack Uptimes

  • poised_shadows_1:17.33%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.59%11.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.4s
  • trigger_min/max:1.0s / 65.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 3.0s
  • uptime_min/max:0.42% / 4.59%

Stack Uptimes

  • premeditation_1:2.59%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0129.7s114.2s4.0s1.66%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.6s
  • trigger_min/max:90.0s / 187.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 11.5s
  • uptime_min/max:0.00% / 7.33%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.66%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow Blades3.60.090.9s90.9s15.8s19.27%17.34%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.2s
  • trigger_min/max:90.0s / 98.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.71% / 21.89%

Stack Uptimes

  • shadow_blades_1:19.27%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.20.023.2s23.2s8.2s36.40%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 72.9s
  • trigger_min/max:8.0s / 72.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.75% / 39.00%

Stack Uptimes

  • shadow_dance_1:36.40%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques67.5136.04.4s1.5s3.5s79.02%95.45%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 43.9s
  • trigger_min/max:0.5s / 6.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.9s
  • uptime_min/max:70.92% / 85.33%

Stack Uptimes

  • shadow_techniques_1:20.51%
  • shadow_techniques_2:20.95%
  • shadow_techniques_3:9.42%
  • shadow_techniques_4:10.46%
  • shadow_techniques_5:6.05%
  • shadow_techniques_6:5.78%
  • shadow_techniques_7:2.56%
  • shadow_techniques_8:2.30%
  • shadow_techniques_9:0.50%
  • shadow_techniques_10:0.45%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.02%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.2s99.32%85.87%98.6 (98.6)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.0104.4s96.1s9.9s1.21%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:12.6s / 291.1s
  • trigger_min/max:1.0s / 281.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 19.0s
  • uptime_min/max:0.00% / 13.85%

Stack Uptimes

  • storm_sewers_citrine_1:1.21%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s11.02%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 69.4s
  • trigger_min/max:3.0s / 69.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.8s
  • uptime_min/max:9.11% / 13.85%

Stack Uptimes

  • supercharge_1_1:11.02%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.02%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 69.4s
  • trigger_min/max:1.0s / 69.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.6s
  • uptime_min/max:0.42% / 4.47%

Stack Uptimes

  • supercharge_2_1:2.02%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.3s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 2.0s
  • uptime_min/max:0.00% / 0.70%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.843.2s21.3s24.4s61.16%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.2s / 97.4s
  • trigger_min/max:1.0s / 69.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 67.0s
  • uptime_min/max:54.72% / 65.13%

Stack Uptimes

  • symbols_of_death_1:61.16%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.6s307.6s27.5s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.7s
  • trigger_min/max:300.0s / 329.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.95% / 18.11%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.82%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.73%22.38%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 69.4s
  • trigger_min/max:1.0s / 69.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 7.4s
  • uptime_min/max:11.29% / 16.97%

Stack Uptimes

  • the_rotten_1:10.67%
  • the_rotten_2:3.06%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.7s
  • trigger_min/max:120.0s / 138.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.39%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)48.424.075.06.1s0.7s71.1s
Skyfury (Off Hand)48.624.076.06.1s0.7s71.0s
Supercharger secret_technique12.48.017.023.8s9.2s92.3s
Cold Blood secret_technique3.63.04.090.7s81.1s100.4s
Supercharger rupture0.30.03.0144.3s25.0s289.5s
Supercharger coup_de_grace2.70.08.076.4s10.2s318.7s
Supercharger eviscerate13.16.020.022.8s1.0s143.9s
CP Spent During Flagellation201.4142.0247.011.2s1.0s90.9s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.03%5.79%12.60%0.7s0.0s2.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 4
Energy RegenEnergy1,409.903,005.4834.00%2.13378.8911.20%
Improved AmbushCombo Points52.2133.334.59%0.6418.8836.16%
PremeditationCombo Points17.1456.737.81%3.3163.2752.72%
Relentless StrikesEnergy106.654,250.4848.08%39.85117.122.68%
Shadow BladesCombo Points22.03114.4115.75%5.1917.7613.44%
Shadow TechniquesEnergy354.581,222.0513.82%3.45196.2613.84%
Shadow TechniquesCombo Points84.84238.3232.82%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points14.95104.6314.41%7.000.000.00%
BackstabCombo Points74.7074.3710.24%1.000.330.44%
ShadowstrikeCombo Points52.21104.4114.38%2.000.020.02%
Symbols of DeathEnergy14.24362.524.10%25.45207.2336.37%
Usage Type Count Total Tot% Avg RPE APR
Combo 4
BackstabEnergy74.702,987.8833.59%40.0040.001,603.10
Coup de GraceEnergy13.20462.145.20%35.0035.0037,302.05
Coup de GraceCombo Points13.2090.2012.49%6.836.83191,115.68
EviscerateEnergy68.002,379.8726.75%35.0035.0020,847.08
EviscerateCombo Points68.00462.7364.06%6.816.81107,219.23
RuptureEnergy9.51237.832.67%25.0025.0065,449.96
RuptureCombo Points9.5165.049.00%6.846.84239,341.98
Secret TechniqueEnergy15.94478.135.38%30.0030.0077,696.97
Secret TechniqueCombo Points15.94104.3314.44%6.556.55356,091.11
ShadowstrikeEnergy52.212,349.5926.41%45.0045.007,996.53
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.5429.73899.445.10.2100.0
Combo Points0.02.432.41100.23.90.07.0

Statistics & Data Analysis

Fight Length
Combo 4 Fight Length
Count 1321
Mean 299.24
Minimum 240.10
Maximum 359.93
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Combo 4 Damage Per Second
Count 1321
Mean 628928.57
Minimum 555402.74
Maximum 695154.33
Spread ( max - min ) 139751.59
Range [ ( max - min ) / 2 * 100% ] 11.11%
Standard Deviation 22730.2299
5th Percentile 590844.90
95th Percentile 664522.94
( 95th Percentile - 5th Percentile ) 73678.04
Mean Distribution
Standard Deviation 625.3921
95.00% Confidence Interval ( 627702.82 - 630154.31 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5018
0.1 Scale Factor Error with Delta=300 4410536
0.05 Scale Factor Error with Delta=300 17642143
0.01 Scale Factor Error with Delta=300 441053556
Priority Target DPS
Combo 4 Priority Target Damage Per Second
Count 1321
Mean 628928.57
Minimum 555402.74
Maximum 695154.33
Spread ( max - min ) 139751.59
Range [ ( max - min ) / 2 * 100% ] 11.11%
Standard Deviation 22730.2299
5th Percentile 590844.90
95th Percentile 664522.94
( 95th Percentile - 5th Percentile ) 73678.04
Mean Distribution
Standard Deviation 625.3921
95.00% Confidence Interval ( 627702.82 - 630154.31 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5018
0.1 Scale Factor Error with Delta=300 4410536
0.05 Scale Factor Error with Delta=300 17642143
0.01 Scale Factor Error with Delta=300 441053556
DPS(e)
Combo 4 Damage Per Second (Effective)
Count 1321
Mean 628928.57
Minimum 555402.74
Maximum 695154.33
Spread ( max - min ) 139751.59
Range [ ( max - min ) / 2 * 100% ] 11.11%
Damage
Combo 4 Damage
Count 1321
Mean 187945245.57
Minimum 148415206.09
Maximum 230409462.95
Spread ( max - min ) 81994256.86
Range [ ( max - min ) / 2 * 100% ] 21.81%
DTPS
Combo 4 Damage Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 4 Healing Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 4 Healing Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 4 Heal
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 4 Healing Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.21 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 74.70 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.47 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.25 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.71 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.94 secret_technique,if=variable.secret
L 9.51 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.20 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.00 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.25 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.91 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKNDNDNDNHDNNQFKDMDNNDNEELHQDNDKDMDNEENEENEHQNDKDNDEMENEENEELEEENEENEEEOLEEJHQPKDIMDNDNNENHQDFKNDNDNNEEMHENEENERELQDKNDNDNDMENHEENENEEEKENEELEEEMEEENEEENEOEJHQPKDINDNDMNELHQDFKDNNDNDMNEEHQKDNNDNDNEELEENEEHQKDMDNDNDENEENRDKEELEEMEEENEEOEJHQPNDIKDNNDNELMHQDNDFKNDNDNNEENEEHNQDKDMDNDGNELEENEEEKEHMENQDNDNDNDKEN

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.003Gpotion
[cds]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes, flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence
0:01.003Jflagellation
[cds]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes, flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.008Neviscerate
[finish]
Fluffy_Pillow 86.2/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.013Rvanish
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.013Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(6), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 73.0/100 73% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Hsymbols_of_death
[cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(5), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Qshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ishadow_blades
[cds]
Combo 4 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(7), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ksecret_technique
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(7), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.032Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(2), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:08.037Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes(2), flawless_form(2), shadow_techniques(2), the_rotten, flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:09.043Neviscerate
[finish]
Fluffy_Pillow 70.2/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:10.047Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:11.054Neviscerate
[finish]
Fluffy_Pillow 70.2/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:12.059Dshadowstrike
[build]
Fluffy_Pillow 93.3/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:13.065Neviscerate
[finish]
Fluffy_Pillow 63.5/100 63% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:14.071Hsymbols_of_death
[cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(10), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:14.071Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(10), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:15.073Neviscerate
[finish]
Fluffy_Pillow 78.2/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(12), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:16.078Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:17.084Qshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:17.084Fcold_blood
[cds]
Combo 4 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), premeditation, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:17.084Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(3), premeditation, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:18.088Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(3), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:19.093Mcoup_de_grace
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:20.298Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:21.303Neviscerate
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:22.309Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:23.313Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:24.317Neviscerate
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
0:25.322Ebackstab
[build]
Fluffy_Pillow 93.6/100 94% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
0:26.328Ebackstab
[build]
Fluffy_Pillow 76.9/100 77% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
0:27.334Lrupture
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
0:28.338Hsymbols_of_death
[cds]
Combo 4 93.4/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
0:28.338Qshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:28.338Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:29.344Neviscerate
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:30.347Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:31.352Ksecret_technique
[finish]
Fluffy_Pillow 78.1/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
0:32.358Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(4), flawless_form(4), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
0:33.362Mcoup_de_grace
[finish]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(5), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
0:34.566Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
0:35.570Neviscerate
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
0:36.573Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
0:37.577Ebackstab
[build]
Fluffy_Pillow 82.2/100 82% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:38.583Neviscerate
[finish]
Fluffy_Pillow 56.2/100 56% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
0:39.587Ebackstab
[build]
Fluffy_Pillow 78.1/100 78% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
0:40.592Ebackstab
[build]
Fluffy_Pillow 58.1/100 58% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:41.597Neviscerate
[finish]
Fluffy_Pillow 36.9/100 37% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:42.602Ebackstab
[build]
Fluffy_Pillow 47.6/100 48% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:44.541Hsymbols_of_death
[cds]
Combo 4 36.3/100 36% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:44.541Qshadow_dance
[stealth_cds]
Combo 4 76.3/100 76% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:44.541Neviscerate
[finish]
Fluffy_Pillow 76.3/100 76% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:45.548Dshadowstrike
[build]
Fluffy_Pillow 90.0/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:46.552Ksecret_technique
[finish]
Fluffy_Pillow 55.7/100 56% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
0:47.555Dshadowstrike
[build]
Fluffy_Pillow 86.4/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
0:48.559Neviscerate
[finish]
Fluffy_Pillow 60.1/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:49.563Dshadowstrike
[build]
Fluffy_Pillow 70.8/100 71% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:50.570Ebackstab
[build]
Fluffy_Pillow 44.6/100 45% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:52.607Mcoup_de_grace
[finish]
Fluffy_Pillow 42.3/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
0:53.812Ebackstab
[build]
Fluffy_Pillow 80.1/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
0:54.818Neviscerate
[finish]
Fluffy_Pillow 58.9/100 59% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
0:55.822Ebackstab
[build]
Fluffy_Pillow 72.6/100 73% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
0:56.827Ebackstab
[build]
Fluffy_Pillow 43.3/100 43% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_crit
0:58.940Neviscerate
[finish]
Fluffy_Pillow 37.8/100 38% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
0:59.946Ebackstab
[build]
Fluffy_Pillow 43.6/100 44% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
1:03.113Ebackstab
[build]
Fluffy_Pillow 45.3/100 45% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:05.064Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, deeper_daggers, flask_of_alchemical_chaos_crit
1:06.068Ebackstab
[build]
Fluffy_Pillow 46.9/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, deeper_daggers, flask_of_alchemical_chaos_crit
1:08.440Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
1.0/7 14% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), flask_of_alchemical_chaos_mastery
1:11.670Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques(2), flask_of_alchemical_chaos_mastery
1:14.121Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:15.125Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:18.146Ebackstab
[build]
Fluffy_Pillow 45.3/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:21.089Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), flawless_form, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:22.092Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:24.700Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:28.143Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:29.976Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 24.1/100 24% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form, shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:30.522Lrupture
[finish]
Fluffy_Pillow 33.8/100 34% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), flawless_form, shadow_techniques(2), realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:31.526Ebackstab
[build]
Fluffy_Pillow 54.3/100 54% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form, shadow_techniques(2), realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:33.341Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form, shadow_techniques(2), realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
1:34.344Jflagellation
[cds]
Fluffy_Pillow 11.2/100 11% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
1:35.347Hsymbols_of_death
[cds]
Combo 4 21.5/100 22% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(3), flawless_form, flagellation_buff, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
1:35.347Qshadow_dance
[stealth_cds]
Combo 4 61.5/100 62% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade(3), flawless_form, the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
1:35.347Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 61.5/100 62% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_mastery
1:35.347Ksecret_technique
[finish]
Fluffy_Pillow 61.5/100 62% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:36.352Dshadowstrike
[build]
Fluffy_Pillow 86.9/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, the_rotten(2), flagellation_buff(10), poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:37.356Ishadow_blades
[cds]
Combo 4 60.3/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:37.356Mcoup_de_grace
[finish]
Fluffy_Pillow 60.3/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:38.561Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(8), shadow_techniques(4), the_rotten, flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:39.567Neviscerate
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:40.572Dshadowstrike
[build]
Fluffy_Pillow 84.3/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:41.576Neviscerate
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:42.579Neviscerate
[finish]
Fluffy_Pillow 68.8/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.585Ebackstab
[build]
Fluffy_Pillow 87.5/100 87% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:44.591Neviscerate
[finish]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.596Hsymbols_of_death
[cds]
Combo 4 76.9/100 77% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.596Qshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.596Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.600Fcold_blood
[cds]
Combo 4 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.600Ksecret_technique
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:47.606Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:48.612Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:49.616Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:50.622Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:51.626Neviscerate
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:52.632Neviscerate
[finish]
Fluffy_Pillow 76.9/100 77% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:53.637Ebackstab
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:54.644Ebackstab
[build]
Fluffy_Pillow 66.3/100 66% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:55.648Mcoup_de_grace
[finish]
Fluffy_Pillow 45.0/100 45% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:56.853Hsymbols_of_death
[cds]
Combo 4 90.9/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:56.853Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:57.858Neviscerate
[finish]
Fluffy_Pillow 70.7/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:58.861Ebackstab
[build]
Fluffy_Pillow 86.4/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:59.865Ebackstab
[build]
Fluffy_Pillow 65.1/100 65% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:00.870Neviscerate
[finish]
Fluffy_Pillow 35.8/100 36% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:01.874Ebackstab
[build]
Fluffy_Pillow 54.6/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:03.627Rvanish
[stealth_cds]
Combo 4 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:03.627Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, vanish, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:04.631Lrupture
[finish]
Fluffy_Pillow 28.0/100 28% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:05.635Qshadow_dance
[stealth_cds]
Combo 4 56.7/100 57% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(8), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:05.635Dshadowstrike
[build]
Fluffy_Pillow 56.7/100 57% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), premeditation, shadow_techniques(8), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:06.639Ksecret_technique
[finish]
Fluffy_Pillow 30.4/100 30% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(10), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
2:07.645Neviscerate
[finish]
Fluffy_Pillow 54.1/100 54% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(5), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
2:08.648Dshadowstrike
[build]
Fluffy_Pillow 72.8/100 73% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:09.652Neviscerate
[finish]
Fluffy_Pillow 38.5/100 39% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:10.656Dshadowstrike
[build]
Fluffy_Pillow 65.2/100 65% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:11.662Neviscerate
[finish]
Fluffy_Pillow 38.9/100 39% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:12.665Dshadowstrike
[build]
Fluffy_Pillow 49.6/100 50% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
2:14.885Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:16.090Ebackstab
[build]
Fluffy_Pillow 82.5/100 82% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:17.092Neviscerate
[finish]
Fluffy_Pillow 53.4/100 53% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:18.096Hsymbols_of_death
[cds]
Combo 4 63.3/100 63% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:18.096Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:19.100Ebackstab
[build]
Fluffy_Pillow 78.9/100 79% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:20.104Neviscerate
[finish]
Fluffy_Pillow 49.9/100 50% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:21.107Ebackstab
[build]
Fluffy_Pillow 81.8/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:22.111Neviscerate
[finish]
Fluffy_Pillow 52.7/100 53% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:23.114Ebackstab
[build]
Fluffy_Pillow 76.7/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:24.118Ebackstab
[build]
Fluffy_Pillow 47.6/100 48% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:26.433Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:28.496Ksecret_technique
[finish]
Fluffy_Pillow 39.3/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:29.500Ebackstab
[build]
Fluffy_Pillow 63.2/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:30.504Neviscerate
[finish]
Fluffy_Pillow 42.1/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:31.509Ebackstab
[build]
Fluffy_Pillow 61.1/100 61% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:32.514Ebackstab
[build]
Fluffy_Pillow 40.0/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:34.702Lrupture
[finish]
Fluffy_Pillow 27.9/100 28% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:35.708Ebackstab
[build]
Fluffy_Pillow 48.6/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:38.298Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:41.737Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_crit
2:44.640Mcoup_de_grace
[finish]
Fluffy_Pillow 39.9/100 40% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), flask_of_alchemical_chaos_crit
2:45.844Ebackstab
[build]
Fluffy_Pillow 77.7/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:46.850Ebackstab
[build]
Fluffy_Pillow 52.5/100 52% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:49.179Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:52.026Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:53.031Ebackstab
[build]
Fluffy_Pillow 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:55.554Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:58.525Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:01.063Neviscerate
[finish]
Fluffy_Pillow 35.3/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_crit
3:02.070Ebackstab
[build]
Fluffy_Pillow 45.7/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
3:03.075Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 16.0/100 16% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form, deeper_daggers, flask_of_alchemical_chaos_crit
3:05.111Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form, shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
3:06.115Jflagellation
[cds]
Fluffy_Pillow 15.2/100 15% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form, shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
3:07.122Hsymbols_of_death
[cds]
Combo 4 25.5/100 25% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:07.122Qshadow_dance
[stealth_cds]
Combo 4 65.5/100 65% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:07.122Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 65.5/100 65% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:07.122Ksecret_technique
[finish]
Fluffy_Pillow 65.5/100 65% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:08.125Dshadowstrike
[build]
Fluffy_Pillow 98.9/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:09.128Ishadow_blades
[cds]
Combo 4 64.4/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:09.128Neviscerate
[finish]
Fluffy_Pillow 64.4/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(10), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:10.134Dshadowstrike
[build]
Fluffy_Pillow 97.9/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:11.138Neviscerate
[finish]
Fluffy_Pillow 63.5/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:12.142Dshadowstrike
[build]
Fluffy_Pillow 82.1/100 82% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:13.147Mcoup_de_grace
[finish]
Fluffy_Pillow 47.8/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(4), flawless_form(4), shadow_techniques(7), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:14.351Neviscerate
[finish]
Fluffy_Pillow 93.7/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:15.355Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:16.361Lrupture
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:17.366Hsymbols_of_death
[cds]
Combo 4 99.5/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:17.366Qshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:17.366Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), premeditation, shadow_techniques(6), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:18.368Fcold_blood
[cds]
Combo 4 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:18.368Ksecret_technique
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:19.371Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(10), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:20.375Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:21.381Neviscerate
[finish]
Fluffy_Pillow 99.5/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:22.385Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:23.389Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:24.393Dshadowstrike
[build]
Fluffy_Pillow 92.5/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:25.398Mcoup_de_grace
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(9), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:26.601Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:27.605Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:28.607Ebackstab
[build]
Fluffy_Pillow 78.7/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:29.612Hsymbols_of_death
[cds]
Combo 4 57.5/100 58% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:29.612Qshadow_dance
[stealth_cds]
Combo 4 97.5/100 98% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:29.612Ksecret_technique
[finish]
Fluffy_Pillow 97.5/100 98% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:30.615Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
3:31.620Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(9), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:32.624Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:33.628Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:34.632Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:35.638Dshadowstrike
[build]
Fluffy_Pillow 92.5/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:36.642Neviscerate
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:37.646Ebackstab
[build]
Fluffy_Pillow 77.0/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:38.650Ebackstab
[build]
Fluffy_Pillow 55.8/100 56% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:39.654Lrupture
[finish]
Fluffy_Pillow 26.6/100 27% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
3:40.661Ebackstab
[build]
Fluffy_Pillow 47.3/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
3:42.327Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:44.757Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:45.761Ebackstab
[build]
Fluffy_Pillow 54.0/100 54% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:47.701Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:49.977Hsymbols_of_death
[cds]
Combo 4 31.1/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:50.023Qshadow_dance
[stealth_cds]
Combo 4 71.6/100 72% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:50.023Ksecret_technique
[finish]
Fluffy_Pillow 71.6/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:51.027Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:52.034Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:53.238Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:54.242Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:55.246Dshadowstrike
[build]
Fluffy_Pillow 84.5/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:56.249Neviscerate
[finish]
Fluffy_Pillow 50.3/100 50% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:57.255Dshadowstrike
[build]
Fluffy_Pillow 69.0/100 69% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:58.697Ebackstab
[build]
Fluffy_Pillow 47.5/100 47% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:00.635Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:01.640Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
4:03.974Ebackstab
[build]
Fluffy_Pillow 40.0/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:06.464Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
4:07.468Rvanish
[stealth_cds]
Combo 4 46.2/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:07.468Dshadowstrike
[build]
Fluffy_Pillow 46.2/100 46% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), premeditation, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:09.854Ksecret_technique
[finish]
Fluffy_Pillow 31.3/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:10.857Ebackstab
[build]
Fluffy_Pillow 51.3/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:13.218Ebackstab
[build]
Fluffy_Pillow 45.1/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:14.696Lrupture
[finish]
Fluffy_Pillow 25.3/100 25% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:15.701Ebackstab
[build]
Fluffy_Pillow 50.3/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:18.160Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:21.006Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:22.211Ebackstab
[build]
Fluffy_Pillow 73.5/100 73% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:23.216Ebackstab
[build]
Fluffy_Pillow 48.5/100 48% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:25.869Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
4:28.389Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:29.395Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
4:32.218Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), deeper_daggers, flask_of_alchemical_chaos_crit
4:34.299Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 31.4/100 31% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:35.205Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
4:36.211Jflagellation
[cds]
Fluffy_Pillow 15.8/100 16% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(2), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
4:37.215Hsymbols_of_death
[cds]
Combo 4 26.1/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), shadow_techniques(2), flagellation_buff, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:37.215Qshadow_dance
[stealth_cds]
Combo 4 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:37.215Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:37.215Neviscerate
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:38.219Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:39.223Ishadow_blades
[cds]
Combo 4 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, escalating_blade, flawless_form, shadow_techniques(6), the_rotten, flagellation_buff(11), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:39.223Ksecret_technique
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, escalating_blade, flawless_form, shadow_techniques(6), the_rotten, flagellation_buff(11), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:40.228Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(21), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:41.232Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(8), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:42.235Neviscerate
[finish]
Fluffy_Pillow 93.1/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_buff(28), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:43.239Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:44.241Neviscerate
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(4), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:45.245Ebackstab
[build]
Fluffy_Pillow 85.2/100 85% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:46.249Lrupture
[finish]
Fluffy_Pillow 64.3/100 64% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(4), flawless_form(5), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:47.253Mcoup_de_grace
[finish]
Fluffy_Pillow 93.4/100 93% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(4), flawless_form(5), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.458Hsymbols_of_death
[cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.458Qshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, flawless_form(10), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.458Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, flawless_form(10), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:49.465Neviscerate
[finish]
Fluffy_Pillow 74.2/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, supercharge_2, flawless_form(10), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:50.470Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:51.476Fcold_blood
[cds]
Combo 4 82.3/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:51.476Ksecret_technique
[finish]
Fluffy_Pillow 82.3/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:52.482Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
4:53.485Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:54.490Neviscerate
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:55.494Dshadowstrike
[build]
Fluffy_Pillow 85.7/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:56.498Neviscerate
[finish]
Fluffy_Pillow 68.0/100 68% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:57.502Neviscerate
[finish]
Fluffy_Pillow 87.3/100 87% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:58.506Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
4:59.509Ebackstab
[build]
Fluffy_Pillow 71.3/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
5:00.513Neviscerate
[finish]
Fluffy_Pillow 50.6/100 51% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
5:01.517Ebackstab
[build]
Fluffy_Pillow 65.0/100 65% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
5:02.519Ebackstab
[build]
Fluffy_Pillow 44.2/100 44% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
5:04.899Hsymbols_of_death
[cds]
Combo 4 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
5:05.023Neviscerate
[finish]
Fluffy_Pillow 76.5/100 76% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
5:06.027Qshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
5:06.027Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
5:07.032Ksecret_technique
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
5:08.038Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
5:09.043Mcoup_de_grace
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:10.247Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:11.251Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:12.256Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:13.261Gpotion
[cds]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:13.261Neviscerate
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:14.267Ebackstab
[build]
Fluffy_Pillow 77.3/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:15.271Lrupture
[finish]
Fluffy_Pillow 56.4/100 56% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:16.275Ebackstab
[build]
Fluffy_Pillow 85.6/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:17.281Ebackstab
[build]
Fluffy_Pillow 64.7/100 65% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:18.286Neviscerate
[finish]
Fluffy_Pillow 35.9/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:19.288Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:21.643Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:24.538Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:27.251Ksecret_technique
[finish]
Fluffy_Pillow 31.3/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, flask_of_alchemical_chaos_vers, tempered_potion
5:28.256Ebackstab
[build]
Fluffy_Pillow 51.4/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:29.945Hsymbols_of_death
[cds]
Combo 4 34.2/100 34% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:30.023Mcoup_de_grace
[finish]
Fluffy_Pillow 75.0/100 75% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques, the_rotten(2), poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:31.228Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, flawless_form(8), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:32.231Neviscerate
[finish]
Fluffy_Pillow 79.1/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:33.235Qshadow_dance
[stealth_cds]
Combo 4 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:33.235Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), premeditation, shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers, tempered_potion
5:34.237Neviscerate
[finish]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers, tempered_potion
5:35.240Dshadowstrike
[build]
Fluffy_Pillow 85.5/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers, tempered_potion
5:36.244Neviscerate
[finish]
Fluffy_Pillow 59.9/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers, tempered_potion
5:37.250Dshadowstrike
[build]
Fluffy_Pillow 79.4/100 79% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, tempered_potion
5:38.256Neviscerate
[finish]
Fluffy_Pillow 54.4/100 54% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, tempered_potion
5:39.259Dshadowstrike
[build]
Fluffy_Pillow 74.4/100 74% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, tempered_potion
5:40.265Ksecret_technique
[finish]
Fluffy_Pillow 49.4/100 49% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, tempered_potion
5:41.269Ebackstab
[build]
Fluffy_Pillow 74.4/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, tempered_potion
5:42.273Neviscerate
[finish]
Fluffy_Pillow 54.3/100 54% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470361443490715598 (13526)
Stamina86452016611915820971757
Intellect12000012360120000
Spirit00000
Health332238031641800
Energy1001000
Combo Points770
Spell Power12360120000
Crit15.02%15.44%2409
Haste2.02%2.02%1336
Versatility10.94%8.32%6490
Attack Power3893635845938
Mastery50.78%33.49%3969
Armor166061660616606
Run Speed800
Leech3.00%3.00%0

Gear

Source Slot Average Item Level: 503.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 437, stats: { 648 Armor, +2,008 Sta, +532 Vers, +314 Mastery, +578 AgiInt }
Local Neck Silken Advisor's Favor
ilevel: 571, stats: { +5,034 Sta, +2,689 Vers, +556 Mastery }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 571, stats: { 2,099 Armor, +6,712 Sta, +685 Vers, +366 Mastery, +1,510 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 571, stats: { 3,053 Armor, +8,949 Sta, +451 Crit, +949 Vers, +2,014 AgiInt }
Local Waist Devourer's Taut Innards
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +731 Vers, +319 Mastery, +1,510 AgiInt }
Local Legs K'areshi Phantom's Leggings
ilevel: 571, stats: { 2,671 Armor, +8,949 Sta, +418 Crit, +983 Mastery, +2,014 AgiInt }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 571, stats: { 1,908 Armor, +6,712 Sta, +328 Vers, +723 Mastery, +1,510 AgiInt }
Local Wrists Rune-Branded Armbands
ilevel: 577, stats: { 1,571 Armor, +5,483 Sta, +797 unknown(24), +797 unknown(25), +1,198 AgiInt }
Local Hands K'areshi Phantom's Grips
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +741 Crit, +309 Haste, +1,510 AgiInt }
Local Finger1 Acidic Attendant's Loop
ilevel: 280, stats: { +100 Sta, +242 Vers, +90 Mastery }
Local Finger2 Ring of Dun Algaz
ilevel: 37, stats: { +3 Sta, +4 Crit, +7 Vers }
Local Trinket1 Treacherous Transmitter
ilevel: 571, stats: { +1,001 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 437, stats: { +549 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 571, stats: { 1,222 Armor, +5,034 Sta, +248 Crit, +540 Mastery, +1,133 StrAgiInt }
Local Main Hand Blood-Kissed Kukri
ilevel: 571, weapon: { 1,545 - 2,576, 1.8 }, stats: { +1,007 Agi, +4,475 Sta, +500 Crit, +200 Vers }, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 577, weapon: { 1,633 - 2,724, 1.8 }, stats: { +1,065 Agi, +4,874 Sta, +709 unknown(24), +709 unknown(25) }, temporary_enchant: Ironclaw Sharpened Weapon

Profile

rogue="Combo 4"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824
neck=silken_advisors_favor,id=225575
shoulders=kareshi_phantoms_shoulderpads,id=212036
back=royal_emblem_of_nerubar,id=212446
chest=kareshi_phantoms_nexus_wraps,id=212041
wrists=runebranded_armbands,id=219334
hands=kareshi_phantoms_grips,id=212039
waist=devourers_taut_innards,id=212425
legs=kareshi_phantoms_leggings,id=212037
feet=kareshi_phantoms_netherwalkers,id=212040
finger1=acidic_attendants_loop,id=225728
finger2=ring_of_dun_algaz,id=133287
trinket1=treacherous_transmitter,id=221023
trinket2=empowering_crystal_of_anubikkaj,id=219312
main_hand=bloodkissed_kukri,id=212395
off_hand=everforged_stabber,id=222438

# Gear Summary
# gear_ilvl=503.44
# gear_agility=15598
# gear_stamina=71757
# gear_attack_power=938
# gear_crit_rating=2362
# gear_haste_rating=1310
# gear_mastery_rating=3891
# gear_versatility_rating=6363
# gear_armor=16606
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 5 : 628,582 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
628,582.1628,582.11,250.3 / 0.199%87,736.2 / 14.0%21,123.4
Resource Out In Waiting APM Active
Energy29.729.512.26%56.9100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 5628,582
Auto Attack 0 (36,883)0.0% (5.9%)3.9122.57s2,821,6210

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 24,5303.9%349.51.00s20,98721,201Direct349.520,75041,78120,98817.3%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage349.53349.530.000.000.000.98990.00007,335,578.039,574,901.8723.39%21,201.4021,201.40
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.39%232.0516430020,750.1812,54133,10420,757.9219,88821,8334,814,8366,285,24923.39%
crit17.26%60.34319441,781.2225,08266,20841,803.1637,95046,3752,520,7423,289,65323.38%
miss16.35%57.1333910.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 12,3522.0%348.81.00s10,59310,664Direct348.810,48021,07610,59417.2%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage348.77348.770.000.000.000.99330.00003,694,588.484,822,352.9923.39%10,664.1610,664.16
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.45%231.7416531010,480.336,38916,67410,485.489,96011,1372,428,7633,170,44523.39%
crit17.22%60.072910021,075.9212,52833,34821,091.9019,11623,2601,265,8251,651,90823.37%
miss16.33%56.9633930.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 15,9202.5%74.63.71s63,96663,680Direct74.639,461102,19763,96939.1%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.5974.590.000.000.001.00450.00004,770,959.146,246,431.7323.62%63,679.8663,679.86
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.94%45.45256939,461.1831,15377,31839,468.8737,36541,8361,793,7972,349,82923.65%
crit39.06%29.131346102,197.1768,537217,958102,240.3092,755115,0442,977,1623,896,60323.62%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:74.58

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 40,362 (57,560)6.4% (9.1%)13.122.66s1,306,9361,085,089Direct39.4 (77.1)240,716478,972305,98227.4% (27.2%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.1439.380.000.000.001.20450.000012,048,932.4315,689,018.8223.20%1,085,089.021,085,089.02
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.60%28.591545240,716.0254,359922,083241,087.90165,517327,4076,883,2128,962,51423.20%
crit27.40%10.79225478,971.55108,7181,747,857479,641.13175,213895,4735,165,7206,726,50523.22%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.14
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 17,1982.7%0.00.00s00Direct37.7106,973214,521135,96827.0%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0037.730.000.000.000.00000.00005,130,196.995,130,196.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.04%27.561441106,972.9525,915379,141107,239.4065,903145,0352,949,0682,949,0680.00%
crit26.96%10.17221214,520.9051,831800,065214,414.6997,846407,9462,181,1292,181,1290.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Eviscerate 115,855 (165,729)18.4% (26.4%)68.04.38s728,060724,799Direct68.0 (134.6)397,267814,051509,04426.8% (26.8%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.0168.010.000.000.001.00450.000034,612,243.8845,026,632.8523.13%724,799.36724,799.36
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.16%49.763169397,266.9295,7241,104,838397,213.92321,851487,16719,758,80125,705,45323.13%
crit26.84%18.25736814,051.06191,4472,139,639815,430.68466,1181,170,67214,853,44219,321,17923.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.01

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 49,8757.9%66.64.47s223,6880Direct66.6174,805357,452223,75326.8%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.6166.610.000.000.000.00000.000014,900,249.8514,900,249.850.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.20%48.763367174,805.4245,636479,318174,773.88145,742207,1378,519,8718,519,8710.00%
crit26.80%17.85631357,452.0191,271934,850357,948.23217,001540,1386,380,3796,380,3790.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 550 (11,155)0.1% (1.8%)3.791.26s901,010897,069Direct3.7 (27.5)37,74975,59444,35517.4% (17.8%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.703.700.000.000.001.00450.0000164,130.14164,130.140.00%897,069.41897,069.41
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.60%3.060437,748.7333,21772,09637,544.69048,802115,430115,4300.00%
crit17.40%0.640475,593.6266,435138,54338,192.650138,54348,70148,7010.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.71
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 10,6051.7%0.00.00s00Direct23.8113,263224,019133,00217.8%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.850.000.000.000.00000.00003,171,173.943,171,173.940.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.16%19.591127113,263.3743,408235,759113,233.0294,640130,8652,218,6942,218,6940.00%
crit17.84%4.25011224,019.4686,817471,518221,628.150419,094952,480952,4800.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 6,4141.0%0.00.00s00Direct279.55,84011,7506,86117.3%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00279.520.000.000.000.00000.00001,917,554.681,917,554.680.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.73%231.251523135,839.884,0979,0365,842.165,5476,1651,350,4291,350,4290.00%
crit17.27%48.27268211,750.308,19418,07211,755.3710,55613,461567,126567,1260.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 43,917 (51,985)7.0% (8.3%)9.531.25s1,630,4201,623,168Periodic164.8 (329.6)62,136129,42979,65826.0% (26.1%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.530.00164.82164.827.071.00451.763713,128,087.3713,128,087.370.00%51,755.661,623,167.67
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.96%121.908416062,135.6496191,48862,163.8853,68471,4067,572,2017,572,2010.00%
crit26.04%42.922372129,428.55128383,742129,603.7297,212173,1805,555,8865,555,8860.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.53
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 8,0681.3%164.81.78s14,6350Periodic164.811,42623,72914,63826.1%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage164.820.000.00164.820.000.00000.00002,412,119.912,412,119.910.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.89%121.798216311,425.744,39035,18211,436.899,92112,7831,391,4551,391,4550.00%
crit26.11%43.03216923,728.998,78070,22323,778.1017,89931,2031,020,6641,020,6640.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (124,421)0.0% (19.8%)15.918.99s2,334,6362,324,317

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.920.000.000.000.001.00450.00000.000.000.00%2,324,316.922,324,316.92

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.92
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 31,9835.1%0.00.00s00Direct15.9312,331997,405600,25842.0%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.920.000.000.000.00000.00009,554,835.5012,459,040.0823.31%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.99%9.23415312,330.9368,374743,574312,752.44197,313438,1662,883,3443,770,98923.54%
crit42.01%6.69312997,404.63136,7481,850,5761,020,153.11619,1181,563,6986,671,4918,688,05123.21%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 92,43714.7%0.00.00s00Direct31.8453,8261,435,734869,85742.4%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.770.000.000.000.00000.000027,622,613.6327,622,613.630.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.65%18.311026453,825.68100,9501,075,297454,647.84325,228607,9418,308,7628,308,7620.00%
crit42.35%13.456231,435,734.22201,9012,676,1541,450,035.37887,9102,157,52319,313,85119,313,8510.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (50,497)0.0% (8.0%)3.690.83s4,140,7920

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.640.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 50,4978.0%382.81.20s39,4190Periodic382.839,415039,4150.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage382.810.000.00382.810.000.00000.000015,089,912.1015,089,912.100.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%382.8128046739,415.0537485,27039,467.4233,22646,69915,089,91215,089,9120.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3878.28
  • base_dd_max:3878.28
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 62,98710.0%52.35.82s359,767358,158Direct52.3152,158495,514359,82360.5%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2552.250.000.000.001.00450.000018,798,282.4624,521,203.9923.34%358,158.03358,158.03
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit39.52%20.651033152,158.2771,021215,170152,152.45135,528167,2753,142,4354,094,46923.26%
crit60.48%31.602246495,514.46156,245726,199495,958.97454,841535,17015,655,84720,426,73523.35%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.24

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Unseen Blade 45,0347.2%57.65.22s233,7000Direct57.6198,952399,673233,68117.3%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.5857.580.000.000.000.00000.000013,457,471.4617,587,690.8323.48%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.69%47.623169198,952.18120,399291,818199,048.10179,054216,5699,472,61012,380,78623.49%
crit17.31%9.97320399,672.62240,799583,635399,968.01298,550538,8543,984,8625,206,90523.48%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 5
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.64s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.58
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.74s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.710.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5307.16s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.47
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.63.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.580.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.223.22s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.24
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 14.221.34s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.25
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.57s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 5
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.91
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1583.1174.7s0.5s277.4s99.94%100.00%573.4 (573.4)0.1

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:32.6s / 347.4s
  • trigger_min/max:0.0s / 4.2s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 359.9s
  • uptime_min/max:98.99% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.16%
  • acrobatic_strikes_10:98.32%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.381.8116.4s3.5s124.6s97.32%0.00%73.3 (76.1)1.3

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 342.1s
  • trigger_min/max:1.0s / 41.1s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 357.2s
  • uptime_min/max:88.42% / 99.44%

Stack Uptimes

  • alacrity_1:3.11%
  • alacrity_2:2.29%
  • alacrity_3:1.84%
  • alacrity_4:1.67%
  • alacrity_5:88.42%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.55%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.55%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows15.90.019.0s19.0s6.9s36.88%100.00%0.0 (0.0)15.5

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 57.6s
  • trigger_min/max:9.2s / 57.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.18% / 41.13%

Stack Uptimes

  • bolstering_shadows_1:36.88%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.43%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.2s / 101.0s
  • trigger_min/max:83.2s / 101.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0131.3s113.2s4.4s1.79%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.6s
  • trigger_min/max:90.0s / 188.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.5s
  • uptime_min/max:0.00% / 7.34%

Stack Uptimes

  • cryptic_instructions_1:1.80%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.247.823.2s23.2s8.2s36.40%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 70.8s
  • trigger_min/max:8.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.59% / 39.00%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.62%
  • danse_macabre_4:16.40%
  • danse_macabre_5:8.79%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.573.641.0s3.7s35.6s89.70%95.51%73.6 (73.6)6.6

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 179.5s
  • trigger_min/max:1.0s / 40.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 161.1s
  • uptime_min/max:79.53% / 95.89%

Stack Uptimes

  • deeper_daggers_1:89.70%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes15.90.019.0s19.0s3.4s18.30%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 57.6s
  • trigger_min/max:9.2s / 57.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.1s
  • uptime_min/max:14.55% / 21.32%

Stack Uptimes

  • disorienting_strikes_1:12.16%
  • disorienting_strikes_2:6.14%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0131.2s111.6s4.0s1.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.0s
  • trigger_min/max:90.0s / 187.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.4s
  • uptime_min/max:0.00% / 7.62%

Stack Uptimes

  • errant_manaforge_emission_1:1.67%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.043.622.2s5.2s17.5s81.62%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 60.0s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.4s
  • uptime_min/max:60.45% / 93.21%

Stack Uptimes

  • escalating_blade_1:24.93%
  • escalating_blade_2:22.13%
  • escalating_blade_3:22.49%
  • escalating_blade_4:12.07%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.8s18.24%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:9013.45

Trigger Details

  • interval_min/max:83.9s / 182.5s
  • trigger_min/max:83.9s / 182.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:12.85% / 20.84%

Stack Uptimes

  • ethereal_powerlink_1:18.24%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.9s14.69%0.00%14.3 (96.1)3.6

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.4s
  • trigger_min/max:1.0s / 88.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s
  • uptime_min/max:12.90% / 16.88%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.04%
  • flagellation_buff_8:0.78%
  • flagellation_buff_9:0.61%
  • flagellation_buff_10:0.55%
  • flagellation_buff_11:0.45%
  • flagellation_buff_12:0.01%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.03%
  • flagellation_buff_18:0.06%
  • flagellation_buff_19:0.41%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.30%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.21%
  • flagellation_buff_25:0.85%
  • flagellation_buff_26:0.35%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.21%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.10%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.26%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.3s / 98.4s
  • trigger_min/max:78.3s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s
  • uptime_min/max:12.36% / 16.26%

Stack Uptimes

  • flagellation_persist_1:0.00%
  • flagellation_persist_30:14.26%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6113.5s76.1s35.5s24.41%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 346.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.0s
  • uptime_min/max:0.00% / 77.15%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.41%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.20.6111.0s76.5s35.2s25.53%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 352.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 78.99%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.53%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.7114.3s76.1s36.3s25.49%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 330.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 240.0s
  • uptime_min/max:0.00% / 88.79%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.49%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.4s74.5s35.8s24.57%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 330.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 79.74%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.57%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form86.70.039.2s3.4s58.5s95.14%100.00%0.0 (0.0)3.9

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.74%
  • flawless_form_2:8.88%
  • flawless_form_3:11.87%
  • flawless_form_4:9.58%
  • flawless_form_5:2.73%
  • flawless_form_6:4.49%
  • flawless_form_7:5.81%
  • flawless_form_8:11.20%
  • flawless_form_9:18.42%
  • flawless_form_10:8.70%
  • flawless_form_11:1.40%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.15%
  • flawless_form_16:0.08%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.287.4s73.1s16.7s10.51%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.9s / 320.3s
  • trigger_min/max:0.2s / 317.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 49.1s
  • uptime_min/max:0.00% / 34.76%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.51%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.286.1s73.5s16.8s10.88%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:3.2s / 304.8s
  • trigger_min/max:0.5s / 298.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 50.7s
  • uptime_min/max:0.00% / 40.42%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.88%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.287.3s74.3s16.7s10.61%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:1.8s / 312.0s
  • trigger_min/max:0.1s / 312.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.6s
  • uptime_min/max:0.00% / 44.13%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.61%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)2.00.286.2s71.5s16.9s11.26%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:3.5s / 300.5s
  • trigger_min/max:0.1s / 300.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 53.0s
  • uptime_min/max:0.00% / 36.23%

Stack Uptimes

  • nascent_empowerment_Vers_1:11.26%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.7s17.23%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 85.2s
  • trigger_min/max:1.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.4s
  • uptime_min/max:9.15% / 28.84%

Stack Uptimes

  • poised_shadows_1:17.23%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.58%11.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.2s
  • trigger_min/max:1.0s / 65.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.76% / 4.74%

Stack Uptimes

  • premeditation_1:2.58%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0130.5s110.3s4.1s1.69%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.9s
  • trigger_min/max:90.0s / 187.2s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 9.9s
  • uptime_min/max:0.00% / 6.72%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.69%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow Blades3.60.090.9s90.9s15.8s19.26%17.33%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.6s
  • trigger_min/max:90.0s / 97.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.75% / 21.90%

Stack Uptimes

  • shadow_blades_1:19.26%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.20.023.2s23.2s8.2s36.40%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 70.8s
  • trigger_min/max:8.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.59% / 39.00%

Stack Uptimes

  • shadow_dance_1:36.40%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques67.6136.24.4s1.5s3.5s79.17%95.47%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 42.6s
  • trigger_min/max:0.5s / 7.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.6s
  • uptime_min/max:72.09% / 88.58%

Stack Uptimes

  • shadow_techniques_1:20.60%
  • shadow_techniques_2:21.04%
  • shadow_techniques_3:9.36%
  • shadow_techniques_4:10.48%
  • shadow_techniques_5:6.07%
  • shadow_techniques_6:5.76%
  • shadow_techniques_7:2.56%
  • shadow_techniques_8:2.30%
  • shadow_techniques_9:0.51%
  • shadow_techniques_10:0.43%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.2s99.32%85.98%98.6 (98.6)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.30.0114.3s103.6s9.9s1.12%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:4.0s / 302.4s
  • trigger_min/max:2.3s / 302.4s
  • trigger_pct:100.00%
  • duration_min/max:1.6s / 15.2s
  • uptime_min/max:0.00% / 11.19%

Stack Uptimes

  • storm_sewers_citrine_1:1.12%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s11.05%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 70.8s
  • trigger_min/max:3.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.0s
  • uptime_min/max:9.20% / 13.39%

Stack Uptimes

  • supercharge_1_1:11.05%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.04%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 70.8s
  • trigger_min/max:1.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.0s
  • uptime_min/max:0.63% / 4.59%

Stack Uptimes

  • supercharge_2_1:2.04%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s0.9s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.0s
  • uptime_min/max:0.00% / 0.68%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.843.4s21.3s24.5s61.15%100.00%6.8 (6.8)6.9

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 96.6s
  • trigger_min/max:1.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:55.27% / 65.22%

Stack Uptimes

  • symbols_of_death_1:61.15%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.6s307.6s27.5s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.7s
  • trigger_min/max:300.0s / 329.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.96% / 18.06%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.82%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.73%22.39%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.5s / 70.8s
  • trigger_min/max:1.0s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.2s
  • uptime_min/max:10.97% / 16.74%

Stack Uptimes

  • the_rotten_1:10.69%
  • the_rotten_2:3.04%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.4s
  • trigger_min/max:120.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.45%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)48.828.076.06.0s0.7s71.7s
Skyfury (Off Hand)48.625.079.06.1s0.7s57.3s
Supercharger secret_technique12.38.017.023.8s9.2s90.3s
Cold Blood secret_technique3.63.04.090.7s83.2s101.0s
Supercharger rupture0.30.03.0198.3s47.1s289.6s
Supercharger coup_de_grace2.80.08.076.8s9.2s343.0s
Supercharger eviscerate13.06.021.022.9s1.0s146.4s
CP Spent During Flagellation202.0140.0249.011.2s1.0s89.2s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.07%5.15%13.41%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 5
Energy RegenEnergy1,410.823,004.6134.01%2.13380.8811.25%
Improved AmbushCombo Points52.2433.314.59%0.6418.9336.24%
PremeditationCombo Points17.1356.647.80%3.3163.2952.77%
Relentless StrikesEnergy106.614,248.2548.08%39.85117.352.69%
Shadow BladesCombo Points22.00114.2515.73%5.1917.7513.45%
Shadow TechniquesEnergy355.021,222.8713.84%3.44197.2213.89%
Shadow TechniquesCombo Points84.77237.8732.76%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.06105.4114.52%7.000.000.00%
BackstabCombo Points74.5874.2210.22%1.000.350.47%
ShadowstrikeCombo Points52.24104.4514.38%2.000.040.04%
Symbols of DeathEnergy14.24359.984.07%25.27209.7436.81%
Usage Type Count Total Tot% Avg RPE APR
Combo 5
BackstabEnergy74.582,983.0533.55%40.0039.991,599.36
Coup de GraceEnergy13.14460.075.17%35.0035.0037,340.45
Coup de GraceCombo Points13.1489.7912.43%6.836.83191,328.95
EviscerateEnergy68.012,380.4226.77%35.0035.0020,799.90
EviscerateCombo Points68.01463.0264.11%6.816.81106,932.89
RuptureEnergy9.53238.302.68%25.0025.0065,213.59
RuptureCombo Points9.5365.139.02%6.836.83238,600.95
Secret TechniqueEnergy15.92477.705.37%30.0030.0077,825.21
Secret TechniqueCombo Points15.92104.2714.44%6.556.55356,534.19
ShadowstrikeEnergy52.242,351.0126.44%45.0044.997,995.85
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.5329.71904.745.10.3100.0
Combo Points0.02.432.41100.33.90.07.0

Statistics & Data Analysis

Fight Length
Combo 5 Fight Length
Count 1321
Mean 299.24
Minimum 240.10
Maximum 359.93
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Combo 5 Damage Per Second
Count 1321
Mean 628582.10
Minimum 559129.58
Maximum 706582.13
Spread ( max - min ) 147452.55
Range [ ( max - min ) / 2 * 100% ] 11.73%
Standard Deviation 23186.3936
5th Percentile 590949.94
95th Percentile 666046.33
( 95th Percentile - 5th Percentile ) 75096.38
Mean Distribution
Standard Deviation 637.9429
95.00% Confidence Interval ( 627331.76 - 629832.45 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5227
0.1 Scale Factor Error with Delta=300 4589339
0.05 Scale Factor Error with Delta=300 18357354
0.01 Scale Factor Error with Delta=300 458933836
Priority Target DPS
Combo 5 Priority Target Damage Per Second
Count 1321
Mean 628582.10
Minimum 559129.58
Maximum 706582.13
Spread ( max - min ) 147452.55
Range [ ( max - min ) / 2 * 100% ] 11.73%
Standard Deviation 23186.3936
5th Percentile 590949.94
95th Percentile 666046.33
( 95th Percentile - 5th Percentile ) 75096.38
Mean Distribution
Standard Deviation 637.9429
95.00% Confidence Interval ( 627331.76 - 629832.45 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5227
0.1 Scale Factor Error with Delta=300 4589339
0.05 Scale Factor Error with Delta=300 18357354
0.01 Scale Factor Error with Delta=300 458933836
DPS(e)
Combo 5 Damage Per Second (Effective)
Count 1321
Mean 628582.10
Minimum 559129.58
Maximum 706582.13
Spread ( max - min ) 147452.55
Range [ ( max - min ) / 2 * 100% ] 11.73%
Damage
Combo 5 Damage
Count 1321
Mean 187808929.98
Minimum 147411007.40
Maximum 232148903.68
Spread ( max - min ) 84737896.28
Range [ ( max - min ) / 2 * 100% ] 22.56%
DTPS
Combo 5 Damage Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 5 Healing Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 5 Healing Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 5 Heal
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 5 Healing Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.24 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 74.58 backstab
actions.cds
# count action,conditions
F 3.58 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.47 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.25 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.71 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.92 secret_technique,if=variable.secret
L 9.53 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.14 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.01 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.24 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.91 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNDMHNDFKNENNENENENHQDKDMDNDNELEENHQDKDNDNDNQDMDNDKDNENEEELEEMEEENEEELEOEJHQPKDINDMNDNENHQNDFKNDNDMNEEEHLENEEENQDKNDNDNDNRDMHENENEEEKEENENEEMEEELEENEEEOJHQPKDINDMDNNENHQNDFKDNNDNELEEHQMDKDNDNDNENEENENEEEHQKDMDNDNDELEENEEKEREMEENEEEOLEEJHQPNDIKNDNDNENNHQDMFKDNNDNELENEENEHQKDMDNDNDGNEENENEEELHEKEQMDNDNDEN

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.005Gpotion
[cds]
Fluffy_Pillow 73.0/100 73% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence
0:01.005Jflagellation
[cds]
Fluffy_Pillow 73.0/100 73% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.011Neviscerate
[finish]
Fluffy_Pillow 91.6/100 92% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(6), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.015Rvanish
[stealth_cds]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(7), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.015Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(7), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.018Lrupture
[finish]
Fluffy_Pillow 69.7/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Hsymbols_of_death
[cds]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Qshadow_dance
[stealth_cds]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.022Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ishadow_blades
[cds]
Combo 5 77.8/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ksecret_technique
[finish]
Fluffy_Pillow 77.8/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.030Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.035Neviscerate
[finish]
Fluffy_Pillow 78.0/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.041Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.046Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.050Neviscerate
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.055Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.060Mcoup_de_grace
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(9), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.265Hsymbols_of_death
[cds]
Combo 5 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.265Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.272Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.277Fcold_blood
[cds]
Combo 5 86.3/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:16.277Ksecret_technique
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:17.283Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:18.288Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:19.293Neviscerate
[finish]
Fluffy_Pillow 83.3/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:20.297Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:21.301Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:22.305Neviscerate
[finish]
Fluffy_Pillow 83.3/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, tempered_potion
0:23.307Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, tempered_potion
0:24.312Neviscerate
[finish]
Fluffy_Pillow 91.3/100 91% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, tempered_potion
0:25.314Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, tempered_potion
0:26.319Neviscerate
[finish]
Fluffy_Pillow 83.3/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, tempered_potion
0:27.324Hsymbols_of_death
[cds]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, tempered_potion
0:27.324Qshadow_dance
[stealth_cds]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, tempered_potion
0:27.324Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, tempered_potion
0:28.328Ksecret_technique
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, tempered_potion
0:29.333Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(4), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, tempered_potion
0:30.338Mcoup_de_grace
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(6), deeper_daggers, bolstering_shadows, tempered_potion
0:31.541Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows
0:32.546Neviscerate
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows
0:33.552Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows
0:34.555Neviscerate
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows
0:35.561Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), deeper_daggers
0:36.566Lrupture
[finish]
Fluffy_Pillow 74.7/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers
0:37.570Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers
0:38.576Ebackstab
[build]
Fluffy_Pillow 82.7/100 83% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers
0:39.581Neviscerate
[finish]
Fluffy_Pillow 65.5/100 65% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers
0:40.584Hsymbols_of_death
[cds]
Combo 5 78.2/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers
0:40.584Qshadow_dance
[stealth_cds]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows
0:40.584Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows
0:41.589Ksecret_technique
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows
0:42.593Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows
0:43.598Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows
0:44.602Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), deeper_daggers, bolstering_shadows
0:45.607Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows
0:46.611Dshadowstrike
[build]
Fluffy_Pillow 93.7/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows
0:47.615Neviscerate
[finish]
Fluffy_Pillow 60.0/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, bolstering_shadows
0:48.621Qshadow_dance
[stealth_cds]
Combo 5 79.3/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers
0:48.621Dshadowstrike
[build]
Fluffy_Pillow 79.3/100 79% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), deeper_daggers
0:49.626Mcoup_de_grace
[finish]
Fluffy_Pillow 53.6/100 54% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), deeper_daggers
0:50.831Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), deeper_daggers
0:51.836Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), deeper_daggers
0:52.839Dshadowstrike
[build]
Fluffy_Pillow 93.6/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), deeper_daggers
0:53.843Ksecret_technique
[finish]
Fluffy_Pillow 68.0/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers
0:54.846Dshadowstrike
[build]
Fluffy_Pillow 84.3/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows
0:55.850Neviscerate
[finish]
Fluffy_Pillow 58.6/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows
0:56.854Ebackstab
[build]
Fluffy_Pillow 77.9/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows
0:57.859Neviscerate
[finish]
Fluffy_Pillow 49.2/100 49% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, bolstering_shadows
0:58.863Ebackstab
[build]
Fluffy_Pillow 59.3/100 59% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:00.476Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:03.934Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
1:05.512Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:06.516Ebackstab
[build]
Fluffy_Pillow 41.9/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flask_of_alchemical_chaos_crit
1:09.348Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), flask_of_alchemical_chaos_crit
1:12.381Mcoup_de_grace
[finish]
Fluffy_Pillow 36.5/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, flask_of_alchemical_chaos_crit
1:13.586Ebackstab
[build]
Fluffy_Pillow 73.6/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:14.589Ebackstab
[build]
Fluffy_Pillow 44.5/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:17.203Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:19.748Neviscerate
[finish]
Fluffy_Pillow 36.7/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:20.752Ebackstab
[build]
Fluffy_Pillow 47.7/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:23.448Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:26.398Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:28.336Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:29.339Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:30.345Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 22.1/100 22% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:32.120Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:33.124Jflagellation
[cds]
Fluffy_Pillow 16.2/100 16% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
1:34.127Hsymbols_of_death
[cds]
Combo 5 26.9/100 27% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, flagellation_buff, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
1:34.127Qshadow_dance
[stealth_cds]
Combo 5 66.9/100 67% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
1:34.127Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.9/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
1:34.127Ksecret_technique
[finish]
Fluffy_Pillow 66.9/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:35.133Dshadowstrike
[build]
Fluffy_Pillow 87.5/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(9), poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:36.138Ishadow_blades
[cds]
Combo 5 68.7/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:36.138Neviscerate
[finish]
Fluffy_Pillow 68.7/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:37.142Dshadowstrike
[build]
Fluffy_Pillow 94.0/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:38.146Mcoup_de_grace
[finish]
Fluffy_Pillow 67.3/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, escalating_blade(4), flawless_form(4), shadow_techniques(7), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:39.350Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:40.354Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:41.358Neviscerate
[finish]
Fluffy_Pillow 65.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:42.363Ebackstab
[build]
Fluffy_Pillow 92.1/100 92% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:43.365Neviscerate
[finish]
Fluffy_Pillow 70.7/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade, flawless_form(9), shadow_techniques(10), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:44.371Hsymbols_of_death
[cds]
Combo 5 81.4/100 81% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:44.371Qshadow_dance
[stealth_cds]
Combo 5 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:44.371Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:45.375Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:46.382Fcold_blood
[cds]
Combo 5 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:46.382Ksecret_technique
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:47.386Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:48.390Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:49.394Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:50.398Dshadowstrike
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:51.403Mcoup_de_grace
[finish]
Fluffy_Pillow 58.1/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:52.607Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:53.611Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:54.615Ebackstab
[build]
Fluffy_Pillow 70.7/100 71% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:55.618Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:56.622Hsymbols_of_death
[cds]
Combo 5 20.1/100 20% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques, flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:56.622Lrupture
[finish]
Fluffy_Pillow 60.1/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:57.627Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:58.630Neviscerate
[finish]
Fluffy_Pillow 70.7/100 71% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:59.635Ebackstab
[build]
Fluffy_Pillow 81.4/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:00.640Ebackstab
[build]
Fluffy_Pillow 60.1/100 60% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:01.848Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:03.639Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), shadow_techniques(4), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:04.646Qshadow_dance
[stealth_cds]
Combo 5 54.9/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:04.825Dshadowstrike
[build]
Fluffy_Pillow 56.8/100 57% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), premeditation, shadow_techniques(6), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:05.829Ksecret_technique
[finish]
Fluffy_Pillow 30.7/100 31% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), shadow_techniques(8), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:06.834Neviscerate
[finish]
Fluffy_Pillow 54.7/100 55% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form, shadow_techniques(3), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:07.837Dshadowstrike
[build]
Fluffy_Pillow 73.6/100 74% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form, shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:08.842Neviscerate
[finish]
Fluffy_Pillow 39.5/100 40% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:09.847Dshadowstrike
[build]
Fluffy_Pillow 58.5/100 58% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:11.107Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:12.111Dshadowstrike
[build]
Fluffy_Pillow 49.1/100 49% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:13.946Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:14.951Rvanish
[stealth_cds]
Combo 5 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:14.951Dshadowstrike
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:17.367Mcoup_de_grace
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:18.571Hsymbols_of_death
[cds]
Combo 5 78.5/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:18.571Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(6), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:19.575Neviscerate
[finish]
Fluffy_Pillow 78.9/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:20.580Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:21.585Neviscerate
[finish]
Fluffy_Pillow 70.9/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:22.588Ebackstab
[build]
Fluffy_Pillow 94.9/100 95% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:23.594Ebackstab
[build]
Fluffy_Pillow 65.8/100 66% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:24.599Ebackstab
[build]
Fluffy_Pillow 44.8/100 45% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:26.246Ksecret_technique
[finish]
Fluffy_Pillow 30.4/100 30% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
2:27.250Ebackstab
[build]
Fluffy_Pillow 54.1/100 54% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
2:28.904Ebackstab
[build]
Fluffy_Pillow 47.7/100 48% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:30.802Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), bolstering_shadows, flask_of_alchemical_chaos_crit
2:31.806Ebackstab
[build]
Fluffy_Pillow 54.7/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:33.345Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:34.350Ebackstab
[build]
Fluffy_Pillow 49.8/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
2:36.907Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:39.369Mcoup_de_grace
[finish]
Fluffy_Pillow 35.4/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:40.573Ebackstab
[build]
Fluffy_Pillow 72.2/100 72% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
2:41.579Ebackstab
[build]
Fluffy_Pillow 42.9/100 43% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), deeper_daggers, flask_of_alchemical_chaos_crit
2:44.396Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:46.745Lrupture
[finish]
Fluffy_Pillow 30.0/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:47.752Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), flask_of_alchemical_chaos_crit
2:49.848Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), flask_of_alchemical_chaos_crit
2:53.106Neviscerate
[finish]
Fluffy_Pillow 39.9/100 40% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flask_of_alchemical_chaos_crit
2:54.114Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:57.064Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:59.976Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:01.219Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 13.5/100 14% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, flask_of_alchemical_chaos_mastery
3:02.986Jflagellation
[cds]
Fluffy_Pillow 36.5/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:04.128Hsymbols_of_death
[cds]
Combo 5 52.7/100 53% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), flagellation_buff, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:04.128Qshadow_dance
[stealth_cds]
Combo 5 92.7/100 93% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:04.128Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 92.7/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_mastery
3:04.128Ksecret_technique
[finish]
Fluffy_Pillow 92.7/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:05.134Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(11), poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:06.139Ishadow_blades
[cds]
Combo 5 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(11), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:06.139Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(11), bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
3:07.143Dshadowstrike
[build]
Fluffy_Pillow 99.5/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:08.148Mcoup_de_grace
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(6), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:09.353Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:10.358Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:11.363Neviscerate
[finish]
Fluffy_Pillow 92.5/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:12.367Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:13.372Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:14.378Hsymbols_of_death
[cds]
Combo 5 97.5/100 98% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:14.378Qshadow_dance
[stealth_cds]
Combo 5 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:14.378Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:15.382Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:16.386Fcold_blood
[cds]
Combo 5 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:16.386Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:17.391Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:18.395Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:19.398Neviscerate
[finish]
Fluffy_Pillow 92.5/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:20.402Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:21.406Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:22.413Ebackstab
[build]
Fluffy_Pillow 84.5/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:23.419Lrupture
[finish]
Fluffy_Pillow 63.3/100 63% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:24.423Ebackstab
[build]
Fluffy_Pillow 84.1/100 84% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:25.427Ebackstab
[build]
Fluffy_Pillow 62.8/100 63% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
3:26.431Hsymbols_of_death
[cds]
Combo 5 41.6/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
3:26.431Qshadow_dance
[stealth_cds]
Combo 5 81.6/100 82% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:26.431Mcoup_de_grace
[finish]
Fluffy_Pillow 81.6/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:27.636Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:28.640Ksecret_technique
[finish]
Fluffy_Pillow 81.7/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:29.644Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
3:30.649Neviscerate
[finish]
Fluffy_Pillow 81.7/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:31.653Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:32.657Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:33.661Dshadowstrike
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:34.666Neviscerate
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:35.671Ebackstab
[build]
Fluffy_Pillow 76.9/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
3:36.675Neviscerate
[finish]
Fluffy_Pillow 55.6/100 56% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:37.680Ebackstab
[build]
Fluffy_Pillow 74.3/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:38.684Ebackstab
[build]
Fluffy_Pillow 53.0/100 53% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:40.110Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
3:41.114Ebackstab
[build]
Fluffy_Pillow 54.9/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
3:42.349Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:43.355Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:46.672Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
3:49.766Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:50.770Hsymbols_of_death
[cds]
Combo 5 15.3/100 15% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(3), shadow_techniques(2), flask_of_alchemical_chaos_vers
3:50.770Qshadow_dance
[stealth_cds]
Combo 5 55.3/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(3), shadow_techniques(2), the_rotten(2), poised_shadows, flask_of_alchemical_chaos_vers
3:50.770Ksecret_technique
[finish]
Fluffy_Pillow 55.3/100 55% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), supercharge_1, supercharge_2, escalating_blade(3), premeditation, shadow_techniques(2), the_rotten(2), poised_shadows, flask_of_alchemical_chaos_vers
3:51.775Dshadowstrike
[build]
Fluffy_Pillow 85.6/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
3:52.779Mcoup_de_grace
[finish]
Fluffy_Pillow 66.9/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(2), shadow_techniques(6), the_rotten, bolstering_shadows, flask_of_alchemical_chaos_vers
3:53.984Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(7), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:54.988Neviscerate
[finish]
Fluffy_Pillow 65.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:55.994Dshadowstrike
[build]
Fluffy_Pillow 84.0/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:56.998Neviscerate
[finish]
Fluffy_Pillow 49.5/100 50% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(2), flawless_form(9), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:58.002Dshadowstrike
[build]
Fluffy_Pillow 68.1/100 68% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:59.005Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
4:00.569Lrupture
[finish]
Fluffy_Pillow 26.4/100 26% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
4:01.573Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
4:03.291Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(4), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
4:06.192Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), escalating_blade(3), flawless_form(2), shadow_techniques(3), flask_of_alchemical_chaos_vers
4:07.199Ebackstab
[build]
Fluffy_Pillow 46.8/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
4:09.661Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:12.074Ksecret_technique
[finish]
Fluffy_Pillow 31.0/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:13.078Ebackstab
[build]
Fluffy_Pillow 46.8/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:15.591Rvanish
[stealth_cds]
Combo 5 41.7/100 42% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:15.591Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
2.0/7 29% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), premeditation, shadow_techniques(2), bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:18.426Mcoup_de_grace
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:19.628Ebackstab
[build]
Fluffy_Pillow 74.0/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:20.634Ebackstab
[build]
Fluffy_Pillow 48.7/100 49% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:22.836Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:23.839Ebackstab
[build]
Fluffy_Pillow 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_vers
4:26.746Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:29.688Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:31.209Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 22.6/100 23% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:31.547Lrupture
[finish]
Fluffy_Pillow 26.4/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:32.550Ebackstab
[build]
Fluffy_Pillow 47.7/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:35.125Ebackstab
[build]
Fluffy_Pillow 40.7/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:36.129Jflagellation
[cds]
Fluffy_Pillow 16.1/100 16% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:37.135Hsymbols_of_death
[cds]
Combo 5 27.4/100 27% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flagellation_buff, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:37.135Qshadow_dance
[stealth_cds]
Combo 5 67.4/100 67% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:37.135Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 67.4/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:37.135Neviscerate
[finish]
Fluffy_Pillow 67.4/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:38.139Dshadowstrike
[build]
Fluffy_Pillow 91.7/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:39.143Ishadow_blades
[cds]
Combo 5 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, shadow_techniques(7), the_rotten, flagellation_buff(9), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:39.143Ksecret_technique
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, shadow_techniques(7), the_rotten, flagellation_buff(9), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:40.147Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(2), the_rotten, flagellation_buff(19), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:41.151Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(2), the_rotten, flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:42.157Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:43.162Dshadowstrike
[build]
Fluffy_Pillow 85.7/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:44.168Neviscerate
[finish]
Fluffy_Pillow 52.0/100 52% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:45.171Ebackstab
[build]
Fluffy_Pillow 71.3/100 71% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:46.175Neviscerate
[finish]
Fluffy_Pillow 50.6/100 51% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:47.181Neviscerate
[finish]
Fluffy_Pillow 70.0/100 70% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.185Hsymbols_of_death
[cds]
Combo 5 89.3/100 89% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.185Qshadow_dance
[stealth_cds]
Combo 5 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.185Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:49.189Mcoup_de_grace
[finish]
Fluffy_Pillow 82.3/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:50.397Fcold_blood
[cds]
Combo 5 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:50.397Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:51.401Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:52.406Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:53.410Neviscerate
[finish]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:54.417Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:55.422Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:56.426Ebackstab
[build]
Fluffy_Pillow 93.7/100 94% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:57.430Lrupture
[finish]
Fluffy_Pillow 73.0/100 73% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
4:58.434Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
4:59.438Neviscerate
[finish]
Fluffy_Pillow 78.7/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
5:00.443Ebackstab
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
5:01.449Ebackstab
[build]
Fluffy_Pillow 71.2/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
5:02.453Neviscerate
[finish]
Fluffy_Pillow 41.9/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
5:03.458Ebackstab
[build]
Fluffy_Pillow 56.6/100 57% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
5:04.919Hsymbols_of_death
[cds]
Combo 5 36.2/100 36% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
5:05.023Qshadow_dance
[stealth_cds]
Combo 5 77.3/100 77% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
5:05.023Ksecret_technique
[finish]
Fluffy_Pillow 77.3/100 77% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
5:06.026Dshadowstrike
[build]
Fluffy_Pillow 96.0/100 96% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
5:07.029Mcoup_de_grace
[finish]
Fluffy_Pillow 69.7/100 70% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:08.232Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:09.237Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:10.242Dshadowstrike
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:11.246Neviscerate
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
5:12.248Dshadowstrike
[build]
Fluffy_Pillow 76.8/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_vers
5:13.254Gpotion
[cds]
Fluffy_Pillow 50.6/100 51% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
5:13.254Neviscerate
[finish]
Fluffy_Pillow 50.6/100 51% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:14.258Ebackstab
[build]
Fluffy_Pillow 64.7/100 65% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:15.263Ebackstab
[build]
Fluffy_Pillow 43.8/100 44% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:17.403Neviscerate
[finish]
Fluffy_Pillow 43.6/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:18.409Ebackstab
[build]
Fluffy_Pillow 54.7/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:19.973Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:20.978Ebackstab
[build]
Fluffy_Pillow 42.2/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:23.774Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:27.408Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, flask_of_alchemical_chaos_vers, tempered_potion
5:29.275Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, flask_of_alchemical_chaos_vers, tempered_potion
5:30.279Hsymbols_of_death
[cds]
Combo 5 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:30.279Ebackstab
[build]
Fluffy_Pillow 86.4/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(2), the_rotten(2), poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:31.282Ksecret_technique
[finish]
Fluffy_Pillow 65.5/100 66% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques(2), the_rotten, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:32.287Ebackstab
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:33.290Qshadow_dance
[stealth_cds]
Combo 5 55.8/100 56% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:33.290Mcoup_de_grace
[finish]
Fluffy_Pillow 55.8/100 56% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), premeditation, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:34.493Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), premeditation, shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:35.498Neviscerate
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:36.502Dshadowstrike
[build]
Fluffy_Pillow 85.3/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:37.506Neviscerate
[finish]
Fluffy_Pillow 59.4/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:38.513Dshadowstrike
[build]
Fluffy_Pillow 70.6/100 71% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:39.516Ebackstab
[build]
Fluffy_Pillow 44.7/100 45% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion
5:41.628Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470361443490715598 (13526)
Stamina86452017568316731880866
Intellect12000012360120000
Spirit00000
Health351366033463600
Energy1001000
Combo Points770
Spell Power12360120000
Crit15.01%15.44%2405
Haste2.02%2.02%1336
Versatility15.85%8.31%6483
Attack Power3893635845938
Mastery37.36%33.49%3969
Armor166061660616606
Run Speed800
Leech3.00%3.00%0

Gear

Source Slot Average Item Level: 539.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 437, stats: { 648 Armor, +2,008 Sta, +532 Vers, +314 Mastery, +578 AgiInt }
Local Neck Silken Advisor's Favor
ilevel: 571, stats: { +5,034 Sta, +2,689 Vers, +556 Mastery }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 571, stats: { 2,099 Armor, +6,712 Sta, +685 Vers, +366 Mastery, +1,510 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 571, stats: { 3,053 Armor, +8,949 Sta, +451 Crit, +949 Vers, +2,014 AgiInt }
Local Waist Devourer's Taut Innards
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +731 Vers, +319 Mastery, +1,510 AgiInt }
Local Legs K'areshi Phantom's Leggings
ilevel: 571, stats: { 2,671 Armor, +8,949 Sta, +418 Crit, +983 Mastery, +2,014 AgiInt }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 571, stats: { 1,908 Armor, +6,712 Sta, +328 Vers, +723 Mastery, +1,510 AgiInt }
Local Wrists Rune-Branded Armbands
ilevel: 577, stats: { 1,571 Armor, +5,483 Sta, +797 unknown(24), +797 unknown(25), +1,198 AgiInt }
Local Hands K'areshi Phantom's Grips
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +741 Crit, +309 Haste, +1,510 AgiInt }
Local Finger1 Acidic Attendant's Loop
ilevel: 280, stats: { +100 Sta, +242 Vers, +90 Mastery }
Local Finger2 Ring of Earthen Craftsmanship
ilevel: 610, stats: { +9,112 Sta, +2,710 unknown(24), +2,710 unknown(25) }
Local Trinket1 Treacherous Transmitter
ilevel: 571, stats: { +1,001 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 437, stats: { +549 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 571, stats: { 1,222 Armor, +5,034 Sta, +248 Crit, +540 Mastery, +1,133 StrAgiInt }
Local Main Hand Blood-Kissed Kukri
ilevel: 571, weapon: { 1,545 - 2,576, 1.8 }, stats: { +1,007 Agi, +4,475 Sta, +500 Crit, +200 Vers }, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 577, weapon: { 1,633 - 2,724, 1.8 }, stats: { +1,065 Agi, +4,874 Sta, +709 unknown(24), +709 unknown(25) }, temporary_enchant: Ironclaw Sharpened Weapon

Profile

rogue="Combo 5"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824
neck=silken_advisors_favor,id=225575
shoulders=kareshi_phantoms_shoulderpads,id=212036
back=royal_emblem_of_nerubar,id=212446
chest=kareshi_phantoms_nexus_wraps,id=212041
wrists=runebranded_armbands,id=219334
hands=kareshi_phantoms_grips,id=212039
waist=devourers_taut_innards,id=212425
legs=kareshi_phantoms_leggings,id=212037
feet=kareshi_phantoms_netherwalkers,id=212040
finger1=acidic_attendants_loop,id=225728
finger2=ring_of_earthen_craftsmanship,id=215135
trinket1=treacherous_transmitter,id=221023
trinket2=empowering_crystal_of_anubikkaj,id=219312
main_hand=bloodkissed_kukri,id=212395
off_hand=everforged_stabber,id=222438

# Gear Summary
# gear_ilvl=539.25
# gear_agility=15598
# gear_stamina=80866
# gear_attack_power=938
# gear_crit_rating=2358
# gear_haste_rating=1310
# gear_mastery_rating=3891
# gear_versatility_rating=6356
# gear_armor=16606
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 6 : 626,844 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
626,844.2626,844.21,196.4 / 0.191%86,044.1 / 13.7%21,063.5
Resource Out In Waiting APM Active
Energy29.729.512.25%56.9100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 6626,844
Auto Attack 0 (36,791)0.0% (5.9%)3.9122.29s2,809,2570

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 24,4523.9%349.61.00s20,91421,127Direct349.620,68741,64720,91517.3%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage349.56349.560.000.000.000.98990.00007,310,784.629,543,952.2123.40%21,126.6921,126.69
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.30%231.7616930520,687.1512,38333,02020,697.2619,67921,5434,794,4526,259,45823.40%
crit17.28%60.42319441,646.8026,27366,04041,670.8637,24746,8562,516,3333,284,49523.39%
miss16.42%57.3831840.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 12,3392.0%348.81.00s10,58010,651Direct348.810,44121,07610,57917.3%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage348.79348.790.000.000.000.99340.00003,690,188.324,817,324.0223.40%10,650.7210,650.72
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.37%231.4816630210,440.916,26816,63210,445.199,91610,9592,416,6363,155,07423.40%
crit17.32%60.423210221,075.6612,69933,26321,090.2519,20123,6411,273,5521,662,25023.39%
miss16.31%56.8932900.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 15,9332.5%74.73.73s63,92663,639Direct74.739,318102,10963,91239.2%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.7074.700.000.000.001.00450.00004,775,497.696,253,377.4723.63%63,639.3663,639.36
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.81%45.43266939,317.7331,06786,42539,326.5836,59941,4411,786,3612,340,78123.67%
crit39.19%29.271351102,108.5268,348211,551102,147.6193,157117,1322,989,1373,912,59623.62%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:74.69

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 40,128 (57,295)6.4% (9.1%)13.222.41s1,293,0591,073,554Direct39.6 (77.6)237,862477,784302,67627.0% (27.2%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2439.650.000.000.001.20450.000011,991,334.9615,614,867.8023.21%1,073,554.301,073,554.30
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.01%28.941643237,862.0654,082881,354237,655.20159,751336,8046,878,2528,957,18623.21%
crit26.99%10.70224477,784.04108,1641,777,844477,015.89170,134914,3085,113,0836,657,68223.21%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.24
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 17,1682.7%0.00.00s00Direct37.9106,025213,007135,39327.4%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0037.930.000.000.000.00000.00005,129,709.065,129,709.060.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.57%27.521244106,025.3525,783382,363106,094.4464,670145,9422,916,1892,916,1890.00%
crit27.43%10.40122213,007.2951,566771,292212,908.0278,931452,6952,213,5202,213,5200.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Eviscerate 115,487 (165,273)18.4% (26.4%)67.94.41s727,364724,114Direct67.9 (134.3)397,045809,140508,37427.0% (27.1%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.8867.880.000.000.001.00450.000034,495,685.8544,875,549.3023.13%724,114.18724,114.18
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.98%49.543267397,045.1395,2361,171,761397,105.76332,424482,90519,665,65825,585,69723.14%
crit27.02%18.34634809,139.89190,4712,184,573808,945.07474,1661,155,25614,830,02819,289,85323.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:67.88

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 49,7867.9%66.44.51s224,0220Direct66.4174,684356,687224,06827.1%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.4066.400.000.000.000.00000.000014,875,867.1514,875,867.150.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.85%48.382966174,684.2345,403508,352174,700.60142,465211,2018,447,3008,447,3000.00%
crit27.15%18.03637356,686.9190,806929,647357,204.25223,825521,0056,428,5676,428,5670.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 550 (11,108)0.1% (1.8%)3.791.27s894,799890,915Direct3.7 (27.5)37,74175,20244,23417.4% (17.7%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000164,306.36164,306.360.00%890,915.32890,915.32
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.56%3.060437,741.2833,12671,90537,646.01050,343115,638115,6380.00%
crit17.44%0.650475,201.9466,251138,16038,334.440138,16048,66848,6680.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.71
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 10,5571.7%0.00.00s00Direct23.8112,724225,038132,65317.7%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.800.000.000.000.00000.00003,156,135.023,156,135.020.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.26%19.581127112,723.7743,288238,747112,666.4394,135131,7052,206,2242,206,2240.00%
crit17.74%4.22011225,037.5486,577470,301221,452.390435,023949,911949,9110.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 6,4011.0%0.00.00s00Direct279.55,82211,7176,84717.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00279.470.000.000.000.00000.00001,913,563.711,913,563.710.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.62%230.891593055,822.364,0859,0135,824.265,5096,1381,344,3001,344,3000.00%
crit17.38%48.58248211,717.318,17118,02611,726.4810,47013,312569,264569,2640.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 43,915 (51,965)7.0% (8.3%)9.531.36s1,629,2441,622,086Periodic164.9 (329.7)61,857128,96579,62626.5% (26.4%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.530.00164.85164.857.061.00451.763313,125,311.7013,125,311.700.00%51,725.531,622,085.66
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.52%121.218215861,856.6944191,09961,904.2052,22870,7727,496,9597,496,9590.00%
crit26.48%43.652368128,965.37422382,199129,078.3089,972162,7145,628,3535,628,3530.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.53
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 8,0501.3%164.91.78s14,5960Periodic164.911,38723,60414,59726.3%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage164.850.000.00164.850.000.00000.00002,406,158.532,406,158.530.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.72%121.538416211,386.654,36835,04011,396.6110,04812,7561,383,6621,383,6620.00%
crit26.28%43.33226723,603.638,73668,84723,636.1016,95631,9411,022,4971,022,4970.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (123,794)0.0% (19.8%)15.919.06s2,322,4522,312,060

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.930.000.000.000.001.00450.00000.000.000.00%2,312,060.212,312,060.21

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.93
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 31,7785.1%0.00.00s00Direct15.9310,507995,985596,31941.7%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.930.000.000.000.00000.00009,497,450.8212,386,686.8123.33%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.30%9.29314310,506.5368,025739,779310,738.36196,250456,4152,882,3743,770,88623.57%
crit41.70%6.64312995,984.64136,0511,872,4911,014,045.26577,4001,516,7106,615,0778,615,80123.22%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 92,01614.7%0.00.00s00Direct31.8452,7041,423,854866,36942.6%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.770.000.000.000.00000.000027,507,072.9127,507,072.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.42%18.24727452,704.35100,0941,069,809453,162.39329,471611,4358,253,2298,253,2290.00%
crit42.58%13.536231,423,854.35206,8972,707,8451,435,988.79986,8082,017,05219,253,84419,253,8440.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (50,338)0.0% (8.0%)3.790.89s4,120,5470

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.66
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 50,3388.0%382.11.21s39,3850Periodic382.139,398039,3980.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage382.140.000.00382.140.000.00000.000015,050,447.2715,050,447.270.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%382.1427946539,398.3417495,46239,423.4134,11145,52815,050,44715,050,4470.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4756.22
  • base_dd_max:4756.22
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 62,79010.0%52.25.77s358,919357,314Direct52.2151,735494,220358,99360.5%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2252.220.000.000.001.00450.000018,741,485.0424,446,780.9523.34%357,314.16357,314.16
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit39.50%20.621131151,734.5570,824214,623151,757.33136,672167,8373,129,2224,076,96423.25%
crit60.50%31.592145494,219.80155,814724,353494,724.27455,233539,06515,612,26320,369,81723.36%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.20

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Unseen Blade 45,1567.2%57.95.18s233,1200Direct57.9198,494397,048233,15417.4%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.8957.890.000.000.000.00000.000013,494,487.9417,636,582.0823.49%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.55%47.793066198,493.91120,067291,076198,593.23184,858213,6349,485,37012,398,55123.50%
crit17.45%10.10222397,047.67240,134582,152397,256.65296,853490,8854,009,1185,238,03123.46%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 6
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.62s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.43s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.720.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5307.11s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.47
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.63.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.580.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.223.21s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.25
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Symbols of Death 14.221.34s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.25
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.29s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.92
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1583.0164.2s0.5s274.6s99.94%100.00%573.2 (573.2)0.1

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.2s / 341.4s
  • trigger_min/max:0.0s / 4.2s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 359.9s
  • uptime_min/max:99.13% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.24%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.16%
  • acrobatic_strikes_10:98.30%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.381.8117.5s3.5s124.7s97.23%0.00%73.3 (76.0)1.3

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.1s / 348.5s
  • trigger_min/max:1.0s / 40.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.6s
  • uptime_min/max:86.91% / 99.44%

Stack Uptimes

  • alacrity_1:3.06%
  • alacrity_2:2.22%
  • alacrity_3:1.86%
  • alacrity_4:1.68%
  • alacrity_5:88.40%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.55%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.55%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows15.90.019.0s19.0s6.9s36.88%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 55.8s
  • trigger_min/max:9.2s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.67% / 41.48%

Stack Uptimes

  • bolstering_shadows_1:36.88%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.7s90.7s0.1s0.00%1.42%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:84.2s / 177.2s
  • trigger_min/max:84.2s / 177.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.06%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0125.9s110.9s4.4s1.79%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.5s
  • trigger_min/max:90.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.1s
  • uptime_min/max:0.00% / 6.74%

Stack Uptimes

  • cryptic_instructions_1:1.79%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.247.823.2s23.2s8.2s36.40%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 72.3s
  • trigger_min/max:8.0s / 72.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.21% / 39.95%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.62%
  • danse_macabre_4:16.39%
  • danse_macabre_5:8.80%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.673.540.6s3.7s35.2s89.69%95.53%73.5 (73.5)6.6

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 172.5s
  • trigger_min/max:1.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 161.1s
  • uptime_min/max:80.16% / 95.95%

Stack Uptimes

  • deeper_daggers_1:89.69%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes15.90.019.0s19.0s3.4s18.29%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 55.8s
  • trigger_min/max:9.2s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.01% / 20.91%

Stack Uptimes

  • disorienting_strikes_1:12.13%
  • disorienting_strikes_2:6.17%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0126.2s111.8s4.1s1.74%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.3s
  • trigger_min/max:90.0s / 188.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.6s
  • uptime_min/max:0.00% / 7.16%

Stack Uptimes

  • errant_manaforge_emission_1:1.75%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.043.822.1s5.2s17.4s81.70%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 62.0s
  • trigger_min/max:1.0s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.5s
  • uptime_min/max:66.93% / 92.85%

Stack Uptimes

  • escalating_blade_1:24.76%
  • escalating_blade_2:22.06%
  • escalating_blade_3:22.68%
  • escalating_blade_4:12.21%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.8s18.25%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:9013.45

Trigger Details

  • interval_min/max:82.6s / 181.1s
  • trigger_min/max:82.6s / 181.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s
  • uptime_min/max:12.57% / 20.84%

Stack Uptimes

  • ethereal_powerlink_1:18.25%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.723.991.3s9.7s11.8s14.70%0.00%14.2 (95.7)3.6

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.2s
  • trigger_min/max:1.0s / 88.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.99% / 16.92%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.04%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.63%
  • flagellation_buff_10:0.53%
  • flagellation_buff_11:0.45%
  • flagellation_buff_12:0.01%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.71%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.03%
  • flagellation_buff_18:0.07%
  • flagellation_buff_19:0.44%
  • flagellation_buff_20:0.38%
  • flagellation_buff_21:0.29%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.20%
  • flagellation_buff_25:0.85%
  • flagellation_buff_26:0.38%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.09%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.27%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.1s / 98.2s
  • trigger_min/max:78.1s / 98.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s
  • uptime_min/max:12.23% / 16.24%

Stack Uptimes

  • flagellation_persist_13:0.00%
  • flagellation_persist_23:0.00%
  • flagellation_persist_26:0.00%
  • flagellation_persist_30:14.26%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6112.3s77.0s35.1s24.74%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 330.0s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.0s
  • uptime_min/max:0.00% / 66.48%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.74%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.20.6112.1s77.1s35.4s25.64%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 312.4s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 76.45%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.64%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6113.1s76.7s35.0s24.92%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.0s
  • uptime_min/max:0.00% / 77.26%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.99%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6108.9s75.0s35.2s24.71%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 329.3s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 191.0s
  • uptime_min/max:0.00% / 78.07%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.71%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.10.040.3s3.4s59.1s95.33%100.00%0.0 (0.0)3.9

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.78%
  • flawless_form_2:8.79%
  • flawless_form_3:11.76%
  • flawless_form_4:9.63%
  • flawless_form_5:2.75%
  • flawless_form_6:4.50%
  • flawless_form_7:5.86%
  • flawless_form_8:11.21%
  • flawless_form_9:18.44%
  • flawless_form_10:8.86%
  • flawless_form_11:1.43%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.15%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)2.00.284.3s70.8s17.0s11.19%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:1.2s / 326.6s
  • trigger_min/max:0.1s / 306.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.9s
  • uptime_min/max:0.00% / 40.60%

Stack Uptimes

  • nascent_empowerment_Crit_1:11.19%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.5s72.9s17.0s10.84%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:3.6s / 299.8s
  • trigger_min/max:0.1s / 299.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.0s
  • uptime_min/max:0.00% / 40.50%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.84%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.285.8s71.8s16.9s10.81%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:2.5s / 287.1s
  • trigger_min/max:0.5s / 287.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 54.3s
  • uptime_min/max:0.00% / 41.34%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.81%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.285.5s71.9s16.8s10.91%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:1391.82

Trigger Details

  • interval_min/max:3.5s / 304.6s
  • trigger_min/max:0.0s / 304.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.3s
  • uptime_min/max:0.00% / 38.15%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.91%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.7s17.22%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 85.1s
  • trigger_min/max:1.0s / 66.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.8s
  • uptime_min/max:9.35% / 28.14%

Stack Uptimes

  • poised_shadows_1:17.22%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.59%11.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.2s
  • trigger_min/max:1.0s / 65.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.81% / 4.83%

Stack Uptimes

  • premeditation_1:2.59%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0126.2s107.8s4.0s1.65%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 330.0s
  • trigger_min/max:90.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 7.14%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.65%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow Blades3.70.090.9s90.9s15.8s19.27%17.34%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 100.4s
  • trigger_min/max:90.0s / 100.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.71% / 21.89%

Stack Uptimes

  • shadow_blades_1:19.27%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.20.023.2s23.2s8.2s36.40%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 72.3s
  • trigger_min/max:8.0s / 72.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.21% / 39.95%

Stack Uptimes

  • shadow_dance_1:36.40%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques67.6136.04.4s1.5s3.5s79.10%95.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 40.5s
  • trigger_min/max:0.5s / 7.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.2s
  • uptime_min/max:71.45% / 86.05%

Stack Uptimes

  • shadow_techniques_1:20.56%
  • shadow_techniques_2:21.07%
  • shadow_techniques_3:9.34%
  • shadow_techniques_4:10.52%
  • shadow_techniques_5:6.00%
  • shadow_techniques_6:5.77%
  • shadow_techniques_7:2.55%
  • shadow_techniques_8:2.29%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.43%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.2s99.32%85.95%98.6 (98.6)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.30.0121.7s118.6s9.9s1.07%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.3s / 298.7s
  • trigger_min/max:1.0s / 298.7s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 16.7s
  • uptime_min/max:0.00% / 11.27%

Stack Uptimes

  • storm_sewers_citrine_1:1.07%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s11.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.2s / 66.5s
  • trigger_min/max:2.2s / 66.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.3s
  • uptime_min/max:9.18% / 14.32%

Stack Uptimes

  • supercharge_1_1:11.08%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.06%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 66.5s
  • trigger_min/max:1.0s / 66.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:0.38% / 6.09%

Stack Uptimes

  • supercharge_2_1:2.06%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.2s
  • uptime_min/max:0.00% / 0.42%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.943.9s21.3s24.8s61.17%100.00%6.9 (6.9)6.8

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 97.5s
  • trigger_min/max:1.0s / 66.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:56.44% / 65.45%

Stack Uptimes

  • symbols_of_death_1:61.17%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.6s307.6s27.4s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.3s
  • trigger_min/max:300.0s / 329.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.96% / 18.08%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.82%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.70%22.38%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 66.5s
  • trigger_min/max:1.0s / 66.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.2s
  • uptime_min/max:11.23% / 16.84%

Stack Uptimes

  • the_rotten_1:10.69%
  • the_rotten_2:3.01%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.1s
  • trigger_min/max:120.0s / 136.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.46%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)48.925.078.06.0s0.7s71.9s
Skyfury (Off Hand)48.627.080.06.1s0.7s61.8s
Supercharger secret_technique12.47.017.023.8s9.2s94.5s
Cold Blood secret_technique3.62.04.090.7s84.2s177.2s
Supercharger rupture0.20.02.0197.7s132.5s269.6s
Supercharger coup_de_grace2.70.08.076.5s8.2s326.4s
Supercharger eviscerate13.15.022.022.9s1.0s147.1s
CP Spent During Flagellation201.7141.0248.011.2s1.0s89.2s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.04%6.06%13.58%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 6
Energy RegenEnergy1,410.653,005.7634.01%2.13379.6011.21%
Improved AmbushCombo Points52.2033.214.57%0.6418.9936.39%
PremeditationCombo Points17.1456.587.79%3.3063.4452.86%
Relentless StrikesEnergy106.584,248.5148.07%39.86118.592.72%
Shadow BladesCombo Points22.03114.3315.75%5.1917.8313.49%
Shadow TechniquesEnergy354.891,224.0713.85%3.45195.4913.77%
Shadow TechniquesCombo Points84.65237.4932.72%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.09105.6214.55%7.000.000.00%
BackstabCombo Points74.6974.2810.23%0.990.420.56%
ShadowstrikeCombo Points52.20104.3714.38%2.000.030.03%
Symbols of DeathEnergy14.24359.504.07%25.24210.2836.91%
Usage Type Count Total Tot% Avg RPE APR
Combo 6
BackstabEnergy74.692,987.7933.60%40.0039.991,598.34
Coup de GraceEnergy13.24463.515.21%35.0035.0136,938.04
Coup de GraceCombo Points13.2490.4012.52%6.836.83189,395.54
EviscerateEnergy67.882,375.7526.72%35.0035.0020,781.49
EviscerateCombo Points67.88462.1164.00%6.816.81106,838.29
RuptureEnergy9.53238.302.68%25.0025.0065,176.92
RuptureCombo Points9.5365.179.03%6.846.84238,304.86
Secret TechniqueEnergy15.93477.915.37%30.0029.9977,430.39
Secret TechniqueCombo Points15.93104.3214.45%6.556.55354,725.26
ShadowstrikeEnergy52.202,349.0826.42%45.0044.997,978.22
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.5429.72903.245.50.0100.0
Combo Points0.02.432.41100.73.90.07.0

Statistics & Data Analysis

Fight Length
Combo 6 Fight Length
Count 1321
Mean 299.24
Minimum 240.10
Maximum 359.93
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Combo 6 Damage Per Second
Count 1321
Mean 626844.25
Minimum 553633.05
Maximum 713817.83
Spread ( max - min ) 160184.78
Range [ ( max - min ) / 2 * 100% ] 12.78%
Standard Deviation 22186.5122
5th Percentile 590843.91
95th Percentile 663798.14
( 95th Percentile - 5th Percentile ) 72954.23
Mean Distribution
Standard Deviation 610.4325
95.00% Confidence Interval ( 625647.82 - 628040.67 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4813
0.1 Scale Factor Error with Delta=300 4202056
0.05 Scale Factor Error with Delta=300 16808221
0.01 Scale Factor Error with Delta=300 420205505
Priority Target DPS
Combo 6 Priority Target Damage Per Second
Count 1321
Mean 626844.25
Minimum 553633.05
Maximum 713817.83
Spread ( max - min ) 160184.78
Range [ ( max - min ) / 2 * 100% ] 12.78%
Standard Deviation 22186.5122
5th Percentile 590843.91
95th Percentile 663798.14
( 95th Percentile - 5th Percentile ) 72954.23
Mean Distribution
Standard Deviation 610.4325
95.00% Confidence Interval ( 625647.82 - 628040.67 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4813
0.1 Scale Factor Error with Delta=300 4202056
0.05 Scale Factor Error with Delta=300 16808221
0.01 Scale Factor Error with Delta=300 420205505
DPS(e)
Combo 6 Damage Per Second (Effective)
Count 1321
Mean 626844.25
Minimum 553633.05
Maximum 713817.83
Spread ( max - min ) 160184.78
Range [ ( max - min ) / 2 * 100% ] 12.78%
Damage
Combo 6 Damage
Count 1321
Mean 187325486.95
Minimum 147531420.52
Maximum 227106668.93
Spread ( max - min ) 79575248.41
Range [ ( max - min ) / 2 * 100% ] 21.24%
DTPS
Combo 6 Damage Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 6 Healing Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 6 Healing Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 6 Heal
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 6 Healing Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.20 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 74.69 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.47 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.25 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.66 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.71 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.93 secret_technique,if=variable.secret
L 9.53 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.24 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 67.88 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.25 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.92 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNNDHNNDQFKDMNDNNDENHQDNDKDNDMELENEENHQDNDKDNDNEEMENEEHLEKEENEEMENEEENEENEEONEEJHQPKDINDMDNNELHQDFKNDNDMNEENEENENEELRDHQKDNNDDMDNEEENEKEEENEELEEMEEENEEEOJHQPKDINDNNNDLHQMDFKDNNDNENENHQDNKDNDMDNEENEELENEEHQKDNDMDDNEENENEREKEELEEEEEMOEJNHQPDINDKNDNNELHQDMNDFKDNNENEENEENEHQNDKDMDNDGLEEENEENEEHKEEQMDNDNDNDNE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, errant_manaforge_emission
0:01.004Gpotion
[cds]
Fluffy_Pillow 68.3/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, errant_manaforge_emission
0:01.004Jflagellation
[cds]
Fluffy_Pillow 68.3/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, errant_manaforge_emission, tempered_potion
0:02.009Neviscerate
[finish]
Fluffy_Pillow 86.1/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(5), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, errant_manaforge_emission, tempered_potion
0:03.014Rvanish
[stealth_cds]
Combo 6 99.9/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(5), flawless_form, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:03.014Dshadowstrike
[build]
Fluffy_Pillow 99.9/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(5), flawless_form, premeditation, shadow_techniques, the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:04.019Lrupture
[finish]
Fluffy_Pillow 72.7/100 73% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(8), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, errant_manaforge_emission, tempered_potion
0:05.023Hsymbols_of_death
[cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, errant_manaforge_emission, tempered_potion
0:05.023Qshadow_dance
[stealth_cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, errant_manaforge_emission, tempered_potion
0:05.023Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, errant_manaforge_emission, tempered_potion
0:05.023Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ishadow_blades
[cds]
Combo 6 76.9/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.027Ksecret_technique
[finish]
Fluffy_Pillow 76.9/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.031Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.035Neviscerate
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.038Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.043Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.048Neviscerate
[finish]
Fluffy_Pillow 77.4/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:12.053Neviscerate
[finish]
Fluffy_Pillow 99.8/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:13.058Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:14.060Hsymbols_of_death
[cds]
Combo 6 85.4/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(7), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:14.060Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:15.064Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:16.068Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:17.073Qshadow_dance
[stealth_cds]
Combo 6 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:17.073Fcold_blood
[cds]
Combo 6 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:17.073Ksecret_technique
[finish]
Fluffy_Pillow 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(3), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:18.076Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(3), premeditation, shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:19.081Mcoup_de_grace
[finish]
Fluffy_Pillow 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, tempered_potion
0:20.285Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, tempered_potion
0:21.291Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, tempered_potion
0:22.295Neviscerate
[finish]
Fluffy_Pillow 93.5/100 93% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, tempered_potion
0:23.299Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, tempered_potion
0:24.303Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, tempered_potion
0:25.308Ebackstab
[build]
Fluffy_Pillow 85.5/100 85% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, tempered_potion
0:26.314Neviscerate
[finish]
Fluffy_Pillow 68.0/100 68% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, tempered_potion
0:27.319Hsymbols_of_death
[cds]
Combo 6 90.5/100 90% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, tempered_potion
0:27.319Qshadow_dance
[stealth_cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:27.319Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:28.323Neviscerate
[finish]
Fluffy_Pillow 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:29.329Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:30.333Ksecret_technique
[finish]
Fluffy_Pillow 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(7), shadow_techniques(5), deeper_daggers, poised_shadows, nascent_empowerment_Vers, tempered_potion
0:31.337Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(3), shadow_techniques(7), deeper_daggers, poised_shadows, bolstering_shadows
0:32.342Neviscerate
[finish]
Fluffy_Pillow 76.9/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows
0:33.347Dshadowstrike
[build]
Fluffy_Pillow 98.9/100 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(7), deeper_daggers, bolstering_shadows
0:34.351Mcoup_de_grace
[finish]
Fluffy_Pillow 75.8/100 76% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:35.555Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:36.559Lrupture
[finish]
Fluffy_Pillow 81.9/100 82% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:37.564Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
0:38.568Neviscerate
[finish]
Fluffy_Pillow 73.9/100 74% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_vers
0:39.573Ebackstab
[build]
Fluffy_Pillow 90.9/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:40.578Ebackstab
[build]
Fluffy_Pillow 78.9/100 79% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:41.583Neviscerate
[finish]
Fluffy_Pillow 57.7/100 58% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:42.588Hsymbols_of_death
[cds]
Combo 6 63.4/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:42.588Qshadow_dance
[stealth_cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
0:42.588Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
0:43.592Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(6), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
0:44.596Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(6), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
0:45.600Ksecret_technique
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
0:46.603Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
0:47.606Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:48.611Dshadowstrike
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:49.617Neviscerate
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:50.622Ebackstab
[build]
Fluffy_Pillow 76.9/100 77% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:51.629Ebackstab
[build]
Fluffy_Pillow 47.6/100 48% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
0:53.370Mcoup_de_grace
[finish]
Fluffy_Pillow 42.2/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:54.574Ebackstab
[build]
Fluffy_Pillow 83.0/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
0:55.579Neviscerate
[finish]
Fluffy_Pillow 61.7/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:56.581Ebackstab
[build]
Fluffy_Pillow 72.4/100 72% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:57.586Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_vers
0:59.684Hsymbols_of_death
[cds]
Combo 6 33.5/100 34% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
0:59.684Lrupture
[finish]
Fluffy_Pillow 73.5/100 74% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:00.689Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(6), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:01.693Ksecret_technique
[finish]
Fluffy_Pillow 78.7/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:02.697Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
1:03.703Ebackstab
[build]
Fluffy_Pillow 70.7/100 71% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), bolstering_shadows, flask_of_alchemical_chaos_vers
1:04.707Neviscerate
[finish]
Fluffy_Pillow 49.4/100 49% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_crit
1:05.710Ebackstab
[build]
Fluffy_Pillow 63.1/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:06.715Ebackstab
[build]
Fluffy_Pillow 41.9/100 42% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:08.645Mcoup_de_grace
[finish]
Fluffy_Pillow 38.4/100 38% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:09.851Ebackstab
[build]
Fluffy_Pillow 84.3/100 84% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(7), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:10.855Neviscerate
[finish]
Fluffy_Pillow 55.0/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:11.857Ebackstab
[build]
Fluffy_Pillow 73.7/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:12.861Ebackstab
[build]
Fluffy_Pillow 44.4/100 44% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:15.076Ebackstab
[build]
Fluffy_Pillow 40.0/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:18.106Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:19.110Ebackstab
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:21.574Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:24.083Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:25.086Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(3), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:27.568Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
1:30.099Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:30.099Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_crit
1:31.106Ebackstab
[build]
Fluffy_Pillow 46.0/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(3), deeper_daggers, cryptic_instructions, flask_of_alchemical_chaos_crit
1:33.940Ebackstab
[build]
Fluffy_Pillow 44.4/100 44% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:34.944Jflagellation
[cds]
Fluffy_Pillow 15.3/100 15% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:35.949Hsymbols_of_death
[cds]
Combo 6 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flagellation_buff, deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:35.949Qshadow_dance
[stealth_cds]
Combo 6 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:35.949Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:35.949Ksecret_technique
[finish]
Fluffy_Pillow 66.2/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:36.954Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:37.958Ishadow_blades
[cds]
Combo 6 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten, flagellation_buff(11), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:37.958Neviscerate
[finish]
Fluffy_Pillow 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten, flagellation_buff(11), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:38.961Dshadowstrike
[build]
Fluffy_Pillow 99.9/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:39.965Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(6), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:41.169Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:42.172Neviscerate
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(10), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:43.176Neviscerate
[finish]
Fluffy_Pillow 84.9/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:44.181Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:45.186Lrupture
[finish]
Fluffy_Pillow 70.9/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:46.192Hsymbols_of_death
[cds]
Combo 6 99.9/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:46.192Qshadow_dance
[stealth_cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(7), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:46.192Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(7), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:47.197Fcold_blood
[cds]
Combo 6 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:47.197Ksecret_technique
[finish]
Fluffy_Pillow 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:48.201Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(10), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:49.204Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:50.210Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:51.216Dshadowstrike
[build]
Fluffy_Pillow 92.9/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:52.220Mcoup_de_grace
[finish]
Fluffy_Pillow 58.8/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
1:53.423Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:54.428Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:55.431Ebackstab
[build]
Fluffy_Pillow 78.7/100 79% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:56.434Neviscerate
[finish]
Fluffy_Pillow 57.4/100 57% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:57.440Ebackstab
[build]
Fluffy_Pillow 76.1/100 76% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:58.444Ebackstab
[build]
Fluffy_Pillow 54.8/100 55% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:59.449Neviscerate
[finish]
Fluffy_Pillow 41.6/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
2:00.453Ebackstab
[build]
Fluffy_Pillow 52.3/100 52% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
2:01.457Neviscerate
[finish]
Fluffy_Pillow 39.0/100 39% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:02.462Ebackstab
[build]
Fluffy_Pillow 44.7/100 45% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
2:05.107Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:07.652Lrupture
[finish]
Fluffy_Pillow 34.1/100 34% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:08.656Rvanish
[stealth_cds]
Combo 6 59.7/100 60% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:08.656Dshadowstrike
[build]
Fluffy_Pillow 59.7/100 60% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, premeditation, shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:10.076Hsymbols_of_death
[cds]
Combo 6 31.0/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:10.076Qshadow_dance
[stealth_cds]
Combo 6 71.0/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(3), the_rotten(2), poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:10.076Ksecret_technique
[finish]
Fluffy_Pillow 71.0/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:11.080Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(5), the_rotten(2), poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:12.086Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(7), the_rotten, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:13.089Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:14.095Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:15.100Dshadowstrike
[build]
Fluffy_Pillow 74.6/100 75% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:16.103Mcoup_de_grace
[finish]
Fluffy_Pillow 49.1/100 49% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:17.308Dshadowstrike
[build]
Fluffy_Pillow 88.0/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:18.313Neviscerate
[finish]
Fluffy_Pillow 54.5/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:19.316Ebackstab
[build]
Fluffy_Pillow 74.0/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:20.320Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:21.921Ebackstab
[build]
Fluffy_Pillow 40.0/100 40% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:24.410Neviscerate
[finish]
Fluffy_Pillow 36.6/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:25.415Ebackstab
[build]
Fluffy_Pillow 52.2/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:26.647Ksecret_technique
[finish]
Fluffy_Pillow 30.4/100 30% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:27.652Ebackstab
[build]
Fluffy_Pillow 41.9/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(6), shadow_techniques, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:30.421Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
2:33.187Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_haste
2:36.135Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flask_of_alchemical_chaos_mastery
2:37.141Ebackstab
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
2:39.571Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:41.462Lrupture
[finish]
Fluffy_Pillow 25.2/100 25% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:42.465Ebackstab
[build]
Fluffy_Pillow 44.9/100 45% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:45.027Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_mastery
2:48.016Mcoup_de_grace
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, flask_of_alchemical_chaos_mastery
2:49.221Ebackstab
[build]
Fluffy_Pillow 69.0/100 69% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:50.225Ebackstab
[build]
Fluffy_Pillow 43.7/100 44% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:53.104Ebackstab
[build]
Fluffy_Pillow 42.4/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
2:55.912Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
2:56.916Ebackstab
[build]
Fluffy_Pillow 47.3/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:59.271Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:02.221Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:03.225Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 12.0/100 12% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
3:04.728Jflagellation
[cds]
Fluffy_Pillow 32.4/100 32% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:05.949Hsymbols_of_death
[cds]
Combo 6 45.7/100 46% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), flagellation_buff, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:05.949Qshadow_dance
[stealth_cds]
Combo 6 85.7/100 86% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:05.949Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:05.949Ksecret_technique
[finish]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:06.956Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(11), poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:07.962Ishadow_blades
[cds]
Combo 6 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(6), the_rotten, flagellation_buff(11), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:07.962Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(6), the_rotten, flagellation_buff(11), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:08.966Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(10), the_rotten, flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:09.972Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(12), flagellation_buff(21), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:10.976Neviscerate
[finish]
Fluffy_Pillow 92.9/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_buff(28), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:11.980Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:12.984Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:13.988Lrupture
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:14.990Hsymbols_of_death
[cds]
Combo 6 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:14.990Qshadow_dance
[stealth_cds]
Combo 6 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:14.990Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:16.194Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:17.199Fcold_blood
[cds]
Combo 6 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:17.199Ksecret_technique
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:18.204Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:19.208Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:20.215Neviscerate
[finish]
Fluffy_Pillow 92.4/100 92% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:21.219Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:22.225Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:23.229Ebackstab
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:24.233Neviscerate
[finish]
Fluffy_Pillow 55.1/100 55% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:25.237Ebackstab
[build]
Fluffy_Pillow 73.9/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:26.242Neviscerate
[finish]
Fluffy_Pillow 52.6/100 53% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:27.248Hsymbols_of_death
[cds]
Combo 6 71.3/100 71% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
3:27.248Qshadow_dance
[stealth_cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:27.248Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), premeditation, shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:28.251Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(3), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:29.256Ksecret_technique
[finish]
Fluffy_Pillow 99.4/100 99% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), shadow_techniques, the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
3:30.262Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
3:31.267Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:32.272Dshadowstrike
[build]
Fluffy_Pillow 84.4/100 84% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:33.275Mcoup_de_grace
[finish]
Fluffy_Pillow 58.1/100 58% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:34.480Dshadowstrike
[build]
Fluffy_Pillow 99.0/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:35.483Neviscerate
[finish]
Fluffy_Pillow 64.7/100 65% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:36.487Ebackstab
[build]
Fluffy_Pillow 83.4/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:37.491Ebackstab
[build]
Fluffy_Pillow 62.1/100 62% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:38.608Neviscerate
[finish]
Fluffy_Pillow 42.0/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:39.613Ebackstab
[build]
Fluffy_Pillow 55.7/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:41.242Ebackstab
[build]
Fluffy_Pillow 49.1/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:42.837Lrupture
[finish]
Fluffy_Pillow 26.1/100 26% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
3:43.843Ebackstab
[build]
Fluffy_Pillow 62.8/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_crit
3:44.847Neviscerate
[finish]
Fluffy_Pillow 37.6/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:45.853Ebackstab
[build]
Fluffy_Pillow 48.3/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:48.557Ebackstab
[build]
Fluffy_Pillow 45.1/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:50.051Hsymbols_of_death
[cds]
Combo 6 21.1/100 21% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, flask_of_alchemical_chaos_crit
3:50.051Qshadow_dance
[stealth_cds]
Combo 6 61.1/100 61% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:50.051Ksecret_technique
[finish]
Fluffy_Pillow 61.1/100 61% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:51.056Dshadowstrike
[build]
Fluffy_Pillow 94.8/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
3:52.060Neviscerate
[finish]
Fluffy_Pillow 60.5/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:53.064Dshadowstrike
[build]
Fluffy_Pillow 94.2/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:54.068Mcoup_de_grace
[finish]
Fluffy_Pillow 67.9/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:55.272Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:56.276Dshadowstrike
[build]
Fluffy_Pillow 73.7/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:57.280Neviscerate
[finish]
Fluffy_Pillow 39.4/100 39% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:58.285Ebackstab
[build]
Fluffy_Pillow 58.1/100 58% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:59.616Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
4:01.406Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
4:02.410Ebackstab
[build]
Fluffy_Pillow 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
4:05.193Neviscerate
[finish]
Fluffy_Pillow 35.9/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:06.196Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:09.081Rvanish
[stealth_cds]
Combo 6 41.4/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:09.081Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
2.0/7 29% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, premeditation, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:11.427Ksecret_technique
[finish]
Fluffy_Pillow 31.1/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:12.432Ebackstab
[build]
Fluffy_Pillow 51.1/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:14.868Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:16.804Lrupture
[finish]
Fluffy_Pillow 26.9/100 27% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:17.808Ebackstab
[build]
Fluffy_Pillow 42.9/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:20.928Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:23.874Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:26.781Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:29.716Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), shadow_techniques(4), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:32.531Mcoup_de_grace
[finish]
Fluffy_Pillow 35.6/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade(4), flawless_form, shadow_techniques(5), nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:33.735Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 77.4/100 77% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques(6), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:33.735Ebackstab
[build]
Fluffy_Pillow 77.4/100 77% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form(6), shadow_techniques(6), deeper_daggers, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:34.737Jflagellation
[cds]
Fluffy_Pillow 48.3/100 48% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(7), deeper_daggers, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:35.948Neviscerate
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), escalating_blade, flawless_form(7), shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:36.953Hsymbols_of_death
[cds]
Combo 6 80.7/100 81% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), escalating_blade, flawless_form(7), shadow_techniques(2), flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:36.953Qshadow_dance
[stealth_cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(2), the_rotten(2), flagellation_buff(8), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:36.953Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(8), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:36.953Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(8), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:37.958Ishadow_blades
[cds]
Combo 6 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(4), the_rotten, flagellation_buff(8), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:37.962Neviscerate
[finish]
Fluffy_Pillow 74.2/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(4), the_rotten, flagellation_buff(8), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:38.967Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(6), the_rotten, flagellation_buff(18), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:39.971Ksecret_technique
[finish]
Fluffy_Pillow 74.2/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(8), flagellation_buff(18), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:40.977Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_buff(28), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:41.982Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:42.987Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:43.991Neviscerate
[finish]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:44.996Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:46.001Lrupture
[finish]
Fluffy_Pillow 79.3/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:47.005Hsymbols_of_death
[cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:47.005Qshadow_dance
[stealth_cds]
Combo 6 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:47.005Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:48.009Mcoup_de_grace
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:49.213Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(10), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:50.218Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:51.223Fcold_blood
[cds]
Combo 6 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:51.223Ksecret_technique
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:52.229Dshadowstrike
[build]
Fluffy_Pillow 90.7/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
4:53.234Neviscerate
[finish]
Fluffy_Pillow 65.0/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:54.240Neviscerate
[finish]
Fluffy_Pillow 76.4/100 76% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
4:55.244Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:56.249Neviscerate
[finish]
Fluffy_Pillow 71.3/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:57.253Ebackstab
[build]
Fluffy_Pillow 90.7/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:58.260Ebackstab
[build]
Fluffy_Pillow 70.0/100 70% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:59.267Neviscerate
[finish]
Fluffy_Pillow 49.4/100 49% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
5:00.269Ebackstab
[build]
Fluffy_Pillow 63.7/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
5:01.272Ebackstab
[build]
Fluffy_Pillow 43.0/100 43% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
5:03.386Neviscerate
[finish]
Fluffy_Pillow 38.8/100 39% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
5:04.389Ebackstab
[build]
Fluffy_Pillow 50.0/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:05.394Hsymbols_of_death
[cds]
Combo 6 24.8/100 25% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:05.394Qshadow_dance
[stealth_cds]
Combo 6 64.8/100 65% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:05.394Neviscerate
[finish]
Fluffy_Pillow 64.8/100 65% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:06.398Dshadowstrike
[build]
Fluffy_Pillow 88.5/100 89% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:07.401Ksecret_technique
[finish]
Fluffy_Pillow 62.3/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form, shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:08.407Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:09.411Mcoup_de_grace
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:10.615Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:11.618Neviscerate
[finish]
Fluffy_Pillow 73.7/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:12.623Dshadowstrike
[build]
Fluffy_Pillow 87.5/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:13.628Gpotion
[cds]
Fluffy_Pillow 53.3/100 53% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
5:13.628Lrupture
[finish]
Fluffy_Pillow 53.3/100 53% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
5:14.633Ebackstab
[build]
Fluffy_Pillow 74.5/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:15.636Ebackstab
[build]
Fluffy_Pillow 53.6/100 54% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:17.366Ebackstab
[build]
Fluffy_Pillow 48.9/100 49% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:19.721Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), flask_of_alchemical_chaos_mastery, tempered_potion
5:20.725Ebackstab
[build]
Fluffy_Pillow 50.3/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:22.919Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:25.544Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:26.548Ebackstab
[build]
Fluffy_Pillow 51.2/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:28.543Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:29.941Hsymbols_of_death
[cds]
Combo 6 21.0/100 21% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery, tempered_potion
5:30.024Ksecret_technique
[finish]
Fluffy_Pillow 61.9/100 62% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
5:31.028Ebackstab
[build]
Fluffy_Pillow 88.1/100 88% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
5:32.031Ebackstab
[build]
Fluffy_Pillow 75.2/100 75% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
5:33.035Qshadow_dance
[stealth_cds]
Combo 6 54.4/100 54% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
5:33.035Mcoup_de_grace
[finish]
Fluffy_Pillow 54.4/100 54% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery, tempered_potion
5:34.239Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:35.244Neviscerate
[finish]
Fluffy_Pillow 66.8/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:36.251Dshadowstrike
[build]
Fluffy_Pillow 86.5/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
5:37.255Neviscerate
[finish]
Fluffy_Pillow 61.3/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:38.259Dshadowstrike
[build]
Fluffy_Pillow 73.0/100 73% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:39.263Neviscerate
[finish]
Fluffy_Pillow 47.8/100 48% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:40.268Dshadowstrike
[build]
Fluffy_Pillow 67.5/100 68% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:41.446Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:42.450Ebackstab
[build]
Fluffy_Pillow 56.1/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470361443490715598 (13526)
Stamina86452017558216722180769
Intellect12000012360120000
Spirit00000
Health351164033444200
Energy1001000
Combo Points770
Spell Power12360120000
Crit20.50%15.44%2409
Haste1.58%2.02%1336
Versatility11.00%8.00%6243
Attack Power3893635845938
Mastery37.04%33.17%3877
Armor166061660616606
Run Speed800
Leech3.00%3.00%0

Gear

Source Slot Average Item Level: 524.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 437, stats: { 648 Armor, +2,008 Sta, +532 Vers, +314 Mastery, +578 AgiInt }
Local Neck Silken Advisor's Favor
ilevel: 571, stats: { +5,034 Sta, +2,689 Vers, +556 Mastery }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 571, stats: { 2,099 Armor, +6,712 Sta, +685 Vers, +366 Mastery, +1,510 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 571, stats: { 3,053 Armor, +8,949 Sta, +451 Crit, +949 Vers, +2,014 AgiInt }
Local Waist Devourer's Taut Innards
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +731 Vers, +319 Mastery, +1,510 AgiInt }
Local Legs K'areshi Phantom's Leggings
ilevel: 571, stats: { 2,671 Armor, +8,949 Sta, +418 Crit, +983 Mastery, +2,014 AgiInt }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 571, stats: { 1,908 Armor, +6,712 Sta, +328 Vers, +723 Mastery, +1,510 AgiInt }
Local Wrists Rune-Branded Armbands
ilevel: 577, stats: { 1,571 Armor, +5,483 Sta, +797 unknown(24), +797 unknown(25), +1,198 AgiInt }
Local Hands K'areshi Phantom's Grips
ilevel: 571, stats: { 1,717 Armor, +6,712 Sta, +741 Crit, +309 Haste, +1,510 AgiInt }
Local Finger1 Ring of Dun Algaz
ilevel: 37, stats: { +3 Sta, +4 Crit, +7 Vers }
Local Finger2 Ring of Earthen Craftsmanship
ilevel: 610, stats: { +9,112 Sta, +2,710 unknown(24), +2,710 unknown(25) }
Local Trinket1 Treacherous Transmitter
ilevel: 571, stats: { +1,001 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 437, stats: { +549 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 571, stats: { 1,222 Armor, +5,034 Sta, +248 Crit, +540 Mastery, +1,133 StrAgiInt }
Local Main Hand Blood-Kissed Kukri
ilevel: 571, weapon: { 1,545 - 2,576, 1.8 }, stats: { +1,007 Agi, +4,475 Sta, +500 Crit, +200 Vers }, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 577, weapon: { 1,633 - 2,724, 1.8 }, stats: { +1,065 Agi, +4,874 Sta, +709 unknown(24), +709 unknown(25) }, temporary_enchant: Ironclaw Sharpened Weapon

Profile

rogue="Combo 6"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824
neck=silken_advisors_favor,id=225575
shoulders=kareshi_phantoms_shoulderpads,id=212036
back=royal_emblem_of_nerubar,id=212446
chest=kareshi_phantoms_nexus_wraps,id=212041
wrists=runebranded_armbands,id=219334
hands=kareshi_phantoms_grips,id=212039
waist=devourers_taut_innards,id=212425
legs=kareshi_phantoms_leggings,id=212037
feet=kareshi_phantoms_netherwalkers,id=212040
finger1=ring_of_dun_algaz,id=133287
finger2=ring_of_earthen_craftsmanship,id=215135
trinket1=treacherous_transmitter,id=221023
trinket2=empowering_crystal_of_anubikkaj,id=219312
main_hand=bloodkissed_kukri,id=212395
off_hand=everforged_stabber,id=222438

# Gear Summary
# gear_ilvl=524.06
# gear_agility=15598
# gear_stamina=80769
# gear_attack_power=938
# gear_crit_rating=2362
# gear_haste_rating=1310
# gear_mastery_rating=3801
# gear_versatility_rating=6121
# gear_armor=16606
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Messerknecht : 1,458,882 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,458,882.11,458,882.12,713.8 / 0.186%194,262.4 / 13.3%48,782.6
Resource Out In Waiting APM Active
Energy29.929.711.66%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Messerknecht1,458,882
Auto Attack 0 (70,330)0.0% (4.8%)3.9122.57s5,374,7720

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,9553.2%353.90.98s39,67340,588Direct353.938,41977,52639,67919.3%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.87353.870.000.000.000.97750.000014,039,006.2018,314,848.3023.35%40,587.7140,587.71
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.27%227.4416330138,419.3423,91264,89238,434.1236,47340,4548,738,21711,400,67123.35%
crit19.32%68.373810577,525.5646,071129,97877,577.3270,62286,7255,300,7896,914,17823.33%
miss16.41%58.0535920.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3751.6%353.30.98s19,78120,165Direct353.319,14238,60219,78419.4%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.28353.280.000.000.000.98100.00006,988,111.039,116,840.1223.35%20,164.7420,164.74
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.23%226.9116329919,142.1011,33032,31319,148.6918,27220,1584,343,4755,666,97323.35%
crit19.39%68.513810838,602.0724,78264,06438,626.6935,36842,7832,644,6363,449,86723.34%
miss16.38%57.8530890.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,2802.1%75.33.67s120,505119,966Direct75.372,996188,684120,50041.1%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.3175.310.000.000.001.00450.00009,075,526.4511,873,773.7023.57%119,965.72119,965.72
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.94%44.39256572,996.2857,139138,84373,006.4468,52178,8243,240,4734,241,32023.59%
crit41.06%30.921557188,684.10125,912375,816188,766.49172,876215,5565,835,0537,632,45323.56%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.31

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,705 (128,094)6.2% (8.8%)13.322.18s2,885,2132,395,487Direct39.7 (78.1)519,3641,049,575674,65729.3% (29.5%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2739.740.000.000.001.20450.000026,818,317.9834,911,642.3723.18%2,395,487.202,395,487.20
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.69%28.091440519,364.06119,2741,904,046519,667.11353,876701,77414,588,46918,992,42723.19%
crit29.31%11.653251,049,575.02239,8463,802,5901,051,224.49507,4132,010,29112,229,84915,919,21623.19%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.27
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,3892.6%0.00.00s00Direct38.3231,127462,023299,42829.6%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.320.000.000.000.00000.000011,473,544.9911,473,544.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.40%26.981243231,126.9357,087826,043231,530.61157,517311,5556,236,1566,236,1560.00%
crit29.60%11.34229462,023.21114,3451,635,684462,274.59224,127764,9825,237,3895,237,3890.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,139)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,1391.4%22.412.81s269,6740Direct22.3269,8020269,8020.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3522.340.000.000.000.00000.00006,028,367.246,028,367.240.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.341142269,802.38260,578314,597269,771.73261,682278,0966,028,3676,028,3670.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 256,380 (367,002)17.6% (25.1%)68.54.37s1,600,0771,592,903Direct68.5 (135.8)860,8951,754,3231,118,04928.8% (28.9%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.5368.530.000.000.001.00450.000076,597,332.1099,640,258.9323.13%1,592,903.221,592,903.22
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.24%48.823269860,895.36210,8622,509,758860,978.14731,7961,023,15442,023,82354,668,63123.13%
crit28.76%19.715341,754,323.45422,3574,757,3021,755,314.851,253,4062,389,13434,573,50944,971,62823.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.54

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,6227.6%67.24.45s491,5010Direct67.2378,628767,375491,52229.1%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.2567.250.000.000.000.00000.000033,053,347.0633,053,347.060.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.95%47.713065378,628.18100,5271,088,823378,751.24317,118456,65618,066,33918,066,3390.00%
crit29.05%19.54632767,375.38201,3562,136,859766,954.99519,7591,054,61314,987,00814,987,0080.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,037 (21,129)0.1% (1.4%)3.791.29s1,702,4081,695,019Direct3.7 (27.6)69,696139,81583,32319.5% (19.7%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.713.710.000.000.001.00450.0000309,321.29309,321.290.00%1,695,019.421,695,019.42
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.54%2.990469,695.5260,925139,09769,557.440129,098208,331208,3310.00%
crit19.46%0.7203139,814.73122,033269,97378,108.870269,429100,990100,9900.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.71
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,0931.4%0.00.00s00Direct23.9209,409423,215251,70519.8%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.870.000.000.000.00000.00006,008,016.086,008,016.080.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.22%19.151027209,408.8377,405443,509209,204.49168,388246,8914,010,1324,010,1320.00%
crit19.78%4.72011423,215.19155,042906,072422,221.700800,8401,997,8841,997,8840.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2220.8%0.00.00s00Direct282.810,80321,72012,91919.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00282.760.000.000.000.00000.00003,653,013.633,653,013.630.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.61%227.9514830310,803.067,51417,71310,805.8310,29511,4582,462,5452,462,5450.00%
crit19.39%54.81299221,720.4715,05135,47921,734.4319,56024,5371,190,4691,190,4690.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,999 (117,229)6.8% (8.0%)9.531.32s3,684,7163,668,215Periodic167.0 (334.1)135,907281,326177,14628.4% (28.4%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.510.00167.04167.047.051.00451.739729,593,105.9429,593,105.940.00%116,748.263,668,214.99
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.63%119.6684157135,907.2775435,745135,994.27120,220152,28716,261,95816,261,9580.00%
crit28.37%47.392677281,325.93166846,804281,836.94216,409387,83113,331,14813,331,1480.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.51
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,2301.2%167.01.76s32,6230Periodic167.024,97951,84032,62328.5%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.040.000.00167.040.000.00000.00005,449,351.855,449,351.850.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.54%119.517316424,979.479,67179,89925,002.3921,86928,1002,985,5032,985,5030.00%
crit28.46%47.53237151,840.4919,371155,32151,895.1341,51864,7102,463,8492,463,8490.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (272,342)0.0% (18.7%)16.018.94s5,090,8565,068,073

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.990.000.000.000.001.00450.00000.000.000.00%5,068,073.305,068,073.30

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.99
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,7594.8%0.00.00s00Direct16.0685,5022,126,2061,303,47742.9%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.990.000.000.000.00000.000020,843,070.2627,165,139.0123.27%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.12%9.13214685,501.83151,5591,613,365686,212.91410,814965,0476,260,8408,182,86523.49%
crit42.88%6.863122,126,205.72301,6844,222,0812,170,728.361,395,7983,268,61814,582,23018,982,27423.18%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 202,58313.9%0.00.00s00Direct31.9996,9563,034,5221,898,22744.2%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.890.000.000.000.00000.000060,545,118.9060,545,118.900.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.76%17.78827996,955.64221,6202,333,117999,094.94739,9271,313,75417,727,99617,727,9960.00%
crit44.24%14.116223,034,522.39466,1016,105,6313,066,042.752,041,4914,203,24642,817,12342,817,1230.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (105,012)0.0% (7.2%)3.790.84s8,598,4280

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.65
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 105,0127.2%385.51.20s81,4570Periodic385.581,432081,4320.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage385.480.000.00385.480.000.00000.000031,399,559.9831,399,559.980.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%385.4829346881,432.49171,078,95681,508.6067,27194,32831,399,56031,399,5600.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6969.90
  • base_dd_max:6969.90
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,7708.1%52.15.85s674,243671,227Direct52.1281,182916,825674,26961.9%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.1352.130.000.000.001.00450.000035,149,452.6645,828,373.5023.30%671,226.61671,226.61
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.15%19.89931281,182.22130,261406,711281,200.20250,950314,4155,592,2657,285,78523.25%
crit61.85%32.242045916,824.74287,0431,392,220917,713.34844,229999,25729,557,18838,542,58823.31%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.12

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,6830.3%2.369.31s477,3780Direct2.3400,752805,007476,84419.0%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.312.310.000.000.000.00000.00001,103,642.721,103,642.720.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.04%1.8707400,752.42377,346480,132336,851.150470,780750,790750,7900.00%
crit18.96%0.4404805,007.03755,824938,204276,548.040923,684352,852352,8520.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8680.1%2.470.53s108,8570Direct2.491,498184,100108,84618.7%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.382.380.000.000.000.00000.0000258,998.26258,998.260.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.26%1.930891,497.7183,958119,80478,191.880113,663176,921176,9210.00%
crit18.74%0.4504184,099.76168,168246,54366,983.340246,54382,07782,0770.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67920.01
  • base_dd_max:67920.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,3553.3%19.214.91s738,7900Periodic107.3132,3220132,3220.0%0.0%71.7%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.210.00107.29107.2912.270.00002.000014,193,043.4714,193,043.470.00%66,144.910.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.2965157132,322.2360,995220,946131,168.9462,446179,63314,193,04314,193,0430.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 55,5813.8%27.710.66s601,1970Direct27.7502,3231,006,979601,10319.6%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage27.6627.660.000.000.000.00000.000016,631,917.2116,631,917.210.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.42%22.25937502,323.48453,001887,606502,008.43465,002576,75911,177,63711,177,6370.00%
crit19.58%5.420131,006,979.27907,3601,695,707999,960.3501,557,9035,454,2805,454,2800.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,5080.3%2.368.63s574,5040Direct2.3480,991966,116574,56519.3%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.342.340.000.000.000.00000.00001,344,278.311,344,278.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.72%1.8908480,990.76452,539567,374408,578.640563,678908,414908,4140.00%
crit19.28%0.4503966,115.62906,4361,146,599348,594.7601,107,313435,864435,8640.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,3405.8%58.05.14s439,4170Direct58.0367,723741,605439,49319.2%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.0458.040.000.000.000.00000.000025,502,819.8333,310,528.1023.44%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.83%46.913167367,722.61220,828572,041367,925.62340,784399,25517,247,58522,529,36923.45%
crit19.17%11.13323741,605.18442,3191,116,375741,702.47557,294924,8498,255,23510,781,15923.44%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Messerknecht
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.690.64s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.560.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.57
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.92s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.720.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.511.41s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.550.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.371.08s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.371.35s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.320.0068.180.000.320.00000.83450.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5307.21s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.47
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.63.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.570.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Shadow Dance 13.323.19s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.27
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.470.53s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.382.380.000.000.000.00000.00000.001,631,914.400.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.38080.00000.000001,631,91490.61%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8680.1%2.470.53s108,8570Direct2.491,498184,100108,84618.7%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.382.380.000.000.000.00000.0000258,998.26258,998.260.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.26%1.930891,497.7183,958119,80478,191.880113,663176,921176,9210.00%
crit18.74%0.4504184,099.76168,168246,54366,983.340246,54382,07782,0770.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67920.01
  • base_dd_max:67920.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.221.33s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.25
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.57s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Messerknecht
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.91
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.471.16s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.370.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1590.2168.5s0.5s279.2s99.94%100.00%580.5 (580.5)0.1

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:42.7s / 331.6s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:7.4s / 359.9s
  • uptime_min/max:99.11% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.34%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.2119.1s3.5s128.5s97.29%0.00%73.8 (76.7)1.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 351.0s
  • trigger_min/max:1.0s / 45.4s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 356.8s
  • uptime_min/max:85.40% / 99.44%

Stack Uptimes

  • alacrity_1:2.98%
  • alacrity_2:2.23%
  • alacrity_3:1.75%
  • alacrity_4:1.70%
  • alacrity_5:88.63%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.55%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.55%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.05%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.2s
  • trigger_min/max:9.2s / 56.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:30.89% / 41.39%

Stack Uptimes

  • bolstering_shadows_1:37.05%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.60.090.6s90.6s0.1s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.3s / 98.8s
  • trigger_min/max:83.3s / 98.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.06%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0130.6s112.4s4.4s1.85%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.6s
  • trigger_min/max:90.0s / 187.8s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 13.9s
  • uptime_min/max:0.00% / 7.77%

Stack Uptimes

  • cryptic_instructions_1:1.85%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.347.923.2s23.2s8.2s36.46%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 71.1s
  • trigger_min/max:8.0s / 71.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.37% / 39.44%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.57%
  • danse_macabre_4:16.50%
  • danse_macabre_5:8.81%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.240.8s3.7s35.5s90.00%95.64%74.2 (74.2)6.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 177.7s
  • trigger_min/max:1.0s / 42.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 152.8s
  • uptime_min/max:81.16% / 95.91%

Stack Uptimes

  • deeper_daggers_1:90.00%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.36%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.2s
  • trigger_min/max:9.2s / 56.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.28% / 22.36%

Stack Uptimes

  • disorienting_strikes_1:12.18%
  • disorienting_strikes_2:6.18%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0126.6s109.5s4.0s1.64%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.6s
  • trigger_min/max:90.0s / 187.2s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 9.7s
  • uptime_min/max:0.00% / 6.27%

Stack Uptimes

  • errant_manaforge_emission_1:1.64%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.022.1s5.2s17.3s81.41%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.9s / 58.9s
  • trigger_min/max:1.0s / 25.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.4s
  • uptime_min/max:62.89% / 92.57%

Stack Uptimes

  • escalating_blade_1:25.02%
  • escalating_blade_2:21.96%
  • escalating_blade_3:22.42%
  • escalating_blade_4:12.01%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.7s90.7s14.8s18.24%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:79.7s / 185.5s
  • trigger_min/max:79.7s / 185.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s
  • uptime_min/max:12.89% / 20.88%

Stack Uptimes

  • ethereal_powerlink_1:18.24%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.282.7s70.8s15.4s10.61%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4413.14

Trigger Details

  • interval_min/max:15.0s / 326.0s
  • trigger_min/max:1.0s / 326.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 47.0s
  • uptime_min/max:0.00% / 42.50%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.61%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.7s11.8s14.70%0.00%14.3 (96.3)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 97.8s
  • trigger_min/max:1.0s / 87.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.91% / 16.89%

Stack Uptimes

  • flagellation_buff_1:1.33%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.59%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.06%
  • flagellation_buff_19:0.41%
  • flagellation_buff_20:0.39%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.19%
  • flagellation_buff_25:0.86%
  • flagellation_buff_26:0.35%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.23%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.12%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.27%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.2s / 97.8s
  • trigger_min/max:78.2s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s
  • uptime_min/max:12.41% / 16.26%

Stack Uptimes

  • flagellation_persist_13:0.00%
  • flagellation_persist_30:14.27%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6113.6s77.6s35.3s24.68%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 172.6s
  • uptime_min/max:0.00% / 67.39%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.68%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6109.8s77.2s34.9s25.12%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:31.6s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 174.5s
  • uptime_min/max:0.00% / 74.23%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.12%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6110.1s76.1s35.1s24.63%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 327.9s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 75.85%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.63%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.20.7112.5s76.5s35.4s25.57%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 343.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 210.0s
  • uptime_min/max:0.00% / 78.08%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.57%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.30.040.9s3.4s60.3s95.39%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.53%
  • flawless_form_2:8.84%
  • flawless_form_3:11.72%
  • flawless_form_4:9.75%
  • flawless_form_5:2.75%
  • flawless_form_6:4.51%
  • flawless_form_7:5.97%
  • flawless_form_8:11.35%
  • flawless_form_9:18.42%
  • flawless_form_10:8.70%
  • flawless_form_11:1.50%
  • flawless_form_12:0.08%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.16%
  • flawless_form_16:0.10%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.286.5s73.1s16.8s10.71%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:4.5s / 317.5s
  • trigger_min/max:0.1s / 317.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 52.6s
  • uptime_min/max:0.00% / 47.51%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.71%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)2.00.283.9s72.1s16.8s11.27%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.1s / 304.6s
  • trigger_min/max:0.4s / 304.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.0s
  • uptime_min/max:0.00% / 42.50%

Stack Uptimes

  • nascent_empowerment_Haste_1:11.27%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)2.00.288.8s75.0s16.7s10.89%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.0s / 332.0s
  • trigger_min/max:0.2s / 332.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.8s
  • uptime_min/max:0.00% / 39.02%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.89%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.285.3s70.0s16.9s10.82%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.1s / 322.1s
  • trigger_min/max:0.2s / 312.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 52.0s
  • uptime_min/max:0.00% / 37.22%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.82%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.422.0s21.3s3.7s16.98%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.6s
  • trigger_min/max:1.0s / 63.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:8.53% / 29.42%

Stack Uptimes

  • poised_shadows_1:16.98%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.60%11.22%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 66.2s
  • trigger_min/max:1.0s / 66.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.36% / 4.85%

Stack Uptimes

  • premeditation_1:2.60%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0129.1s111.8s3.9s1.62%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.1s
  • trigger_min/max:90.0s / 187.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.7s
  • uptime_min/max:0.00% / 6.06%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.62%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.284.0s71.4s15.3s10.59%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23922.58

Trigger Details

  • interval_min/max:15.1s / 337.8s
  • trigger_min/max:1.0s / 337.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.8s
  • uptime_min/max:0.00% / 39.78%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.59%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.70.090.8s90.8s15.8s19.28%17.23%0.0 (0.0)3.5

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.9s
  • trigger_min/max:90.0s / 98.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.71% / 21.87%

Stack Uptimes

  • shadow_blades_1:19.28%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.2s23.2s8.2s36.46%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 71.1s
  • trigger_min/max:8.0s / 71.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.37% / 39.44%

Stack Uptimes

  • shadow_dance_1:36.46%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.0138.34.4s1.4s3.5s79.18%95.54%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 41.1s
  • trigger_min/max:0.5s / 6.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.0s
  • uptime_min/max:71.97% / 86.88%

Stack Uptimes

  • shadow_techniques_1:20.53%
  • shadow_techniques_2:20.89%
  • shadow_techniques_3:9.35%
  • shadow_techniques_4:10.48%
  • shadow_techniques_5:6.11%
  • shadow_techniques_6:5.82%
  • shadow_techniques_7:2.62%
  • shadow_techniques_8:2.34%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.47%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s297.2s99.32%87.80%98.6 (98.6)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.30.0127.3s115.6s9.8s1.10%0.00%0.0 (0.0)0.3

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:19.0s / 337.3s
  • trigger_min/max:3.9s / 337.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 16.6s
  • uptime_min/max:0.00% / 10.62%

Stack Uptimes

  • storm_sewers_citrine_1:1.10%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.283.5s71.6s15.4s10.98%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1374.86
  • stat:haste_rating
  • amount:1374.86
  • stat:mastery_rating
  • amount:1374.86
  • stat:versatility_rating
  • amount:1374.86

Trigger Details

  • interval_min/max:15.0s / 312.4s
  • trigger_min/max:1.0s / 312.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.3s
  • uptime_min/max:0.00% / 39.63%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.98%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s10.98%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 63.0s
  • trigger_min/max:3.0s / 63.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.8s
  • uptime_min/max:9.03% / 13.39%

Stack Uptimes

  • supercharge_1_1:10.98%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.03%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 63.0s
  • trigger_min/max:1.0s / 63.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.7s
  • uptime_min/max:0.36% / 4.72%

Stack Uptimes

  • supercharge_2_1:2.03%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 2.0s
  • uptime_min/max:0.00% / 0.68%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.943.9s21.3s24.8s61.17%100.00%6.9 (6.9)6.8

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.2s / 95.1s
  • trigger_min/max:1.0s / 63.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:57.82% / 65.22%

Stack Uptimes

  • symbols_of_death_1:61.17%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0307.6s307.6s27.5s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.7s
  • trigger_min/max:300.0s / 329.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s
  • uptime_min/max:9.95% / 18.07%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.81%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.80%22.29%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:4.0s / 63.0s
  • trigger_min/max:1.0s / 63.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.4s
  • uptime_min/max:11.35% / 16.86%

Stack Uptimes

  • the_rotten_1:10.74%
  • the_rotten_2:3.06%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.3s122.3s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 135.4s
  • trigger_min/max:120.0s / 135.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.38%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.0135.7s58.9s15.2s0.49%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4550.35

Trigger Details

  • interval_min/max:76.0s / 213.2s
  • trigger_min/max:1.0s / 213.2s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 29.3s
  • uptime_min/max:0.00% / 12.11%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.55%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.10.283.6s72.1s15.3s10.60%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5499.44

Trigger Details

  • interval_min/max:15.1s / 298.4s
  • trigger_min/max:1.0s / 298.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 53.7s
  • uptime_min/max:0.00% / 36.42%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.60%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.325.083.06.0s0.7s88.5s
Skyfury (Off Hand)49.323.075.06.0s0.7s66.0s
Supercharger secret_technique12.47.016.023.6s9.2s88.7s
Cold Blood secret_technique3.63.04.090.6s83.3s98.8s
Supercharger rupture0.30.02.0197.6s35.7s278.5s
Supercharger coup_de_grace2.70.08.076.8s9.2s324.0s
Supercharger eviscerate13.07.020.023.1s1.0s150.0s
CP Spent During Flagellation202.3143.0248.011.2s1.0s91.6s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.40%5.76%13.54%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Messerknecht
Energy RegenEnergy1,428.923,029.9334.10%2.12398.7411.63%
Improved AmbushCombo Points52.1233.324.56%0.6418.8136.08%
PremeditationCombo Points17.1756.787.77%3.3163.4452.77%
Relentless StrikesEnergy107.314,269.8248.05%39.79124.482.83%
Shadow BladesCombo Points21.98114.1515.61%5.1917.7113.43%
Shadow TechniquesEnergy359.491,231.6813.86%3.43206.2914.35%
Shadow TechniquesCombo Points85.44240.3732.88%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.34107.3514.68%7.000.000.00%
BackstabCombo Points75.3174.9310.25%0.990.380.51%
ShadowstrikeCombo Points52.12104.2114.25%2.000.030.03%
Symbols of DeathEnergy14.25354.223.99%24.86215.6237.84%
Usage Type Count Total Tot% Avg RPE APR
Messerknecht
BackstabEnergy75.313,012.5433.70%40.0040.003,012.58
Coup de GraceEnergy13.27464.435.20%35.0034.9982,449.85
Coup de GraceCombo Points13.2790.6412.46%6.836.83422,450.91
EviscerateEnergy68.542,398.9826.84%35.0035.0145,707.14
EviscerateCombo Points68.54467.0864.22%6.816.82234,760.32
RuptureEnergy9.51237.812.66%25.0025.01147,355.19
RuptureCombo Points9.5165.068.95%6.846.84538,580.16
Secret TechniqueEnergy15.99479.665.37%30.0030.00169,678.06
Secret TechniqueCombo Points15.99104.5414.37%6.546.54778,563.27
ShadowstrikeEnergy52.122,345.5426.24%45.0044.9914,985.68
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6929.87944.646.70.2100.0
Combo Points0.02.442.43100.33.80.07.0

Statistics & Data Analysis

Fight Length
Messerknecht Fight Length
Count 1321
Mean 299.24
Minimum 240.10
Maximum 359.93
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Messerknecht Damage Per Second
Count 1321
Mean 1458882.15
Minimum 1300988.14
Maximum 1627768.92
Spread ( max - min ) 326780.77
Range [ ( max - min ) / 2 * 100% ] 11.20%
Standard Deviation 50325.3073
5th Percentile 1375810.29
95th Percentile 1542385.43
( 95th Percentile - 5th Percentile ) 166575.13
Mean Distribution
Standard Deviation 1384.6341
95.00% Confidence Interval ( 1456168.31 - 1461595.98 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4572
0.1 Scale Factor Error with Delta=300 21620043
0.05 Scale Factor Error with Delta=300 86480170
0.01 Scale Factor Error with Delta=300 2162004234
Priority Target DPS
Messerknecht Priority Target Damage Per Second
Count 1321
Mean 1458882.15
Minimum 1300988.14
Maximum 1627768.92
Spread ( max - min ) 326780.77
Range [ ( max - min ) / 2 * 100% ] 11.20%
Standard Deviation 50325.3073
5th Percentile 1375810.29
95th Percentile 1542385.43
( 95th Percentile - 5th Percentile ) 166575.13
Mean Distribution
Standard Deviation 1384.6341
95.00% Confidence Interval ( 1456168.31 - 1461595.98 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4572
0.1 Scale Factor Error with Delta=300 21620043
0.05 Scale Factor Error with Delta=300 86480170
0.01 Scale Factor Error with Delta=300 2162004234
DPS(e)
Messerknecht Damage Per Second (Effective)
Count 1321
Mean 1458882.15
Minimum 1300988.14
Maximum 1627768.92
Spread ( max - min ) 326780.77
Range [ ( max - min ) / 2 * 100% ] 11.20%
Damage
Messerknecht Damage
Count 1321
Mean 436058263.43
Minimum 334410657.24
Maximum 532985164.31
Spread ( max - min ) 198574507.07
Range [ ( max - min ) / 2 * 100% ] 22.77%
DTPS
Messerknecht Damage Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Messerknecht Healing Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Messerknecht Healing Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Messerknecht Heal
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Messerknecht Healing Taken Per Second
Count 1321
Mean 2732.48
Minimum 0.00
Maximum 9523.20
Spread ( max - min ) 9523.20
Range [ ( max - min ) / 2 * 100% ] 174.26%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.12 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.31 backstab
actions.cds
# count action,conditions
F 3.57 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.47 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.25 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.65 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.71 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.99 secret_technique,if=variable.secret
L 9.51 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.27 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.54 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.70 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.27 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.91 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDMDNHNDFKENNEMQNDNNHDKDNEELEEMEENEHQNDKDNDNDNEENENHQDNDKMDNDLEENEENEEENEEEOLEJHQPKDMIDNNDNNENHQDFKNDNDMNENEENENEEELREHQKDNDMDNDNEENEEELEEKEEEMEENEEENOEEJHQPNDIKDNDNNELEHQMNDFKNDNNEEHNQDNDNDKDMELEENENENEEEHQKDNDMDNDNENEEKEERELEEMEENEEENOEEJHQPKDIMDNNDNELHQNDFKNDNDMNENENEEEHQKDNDNDNDGLEEMEENENEEEKHENEQMDNDNDNDNE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, errant_manaforge_emission
0:01.004Gpotion
[cds]
Fluffy_Pillow 68.4/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, errant_manaforge_emission
0:01.004Jflagellation
[cds]
Fluffy_Pillow 68.4/100 68% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, the_first_dance, errant_manaforge_emission, tempered_potion
0:02.009Neviscerate
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, errant_manaforge_emission, tempered_potion
0:03.016Rvanish
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, stormbringers_runed_citrine_proc, errant_manaforge_emission, tempered_potion
0:03.016Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(6), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, stormbringers_runed_citrine_proc, errant_manaforge_emission, tempered_potion
0:04.020Lrupture
[finish]
Fluffy_Pillow 73.3/100 73% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, stormbringers_runed_citrine_proc, errant_manaforge_emission, tempered_potion
0:05.026Hsymbols_of_death
[cds]
Messerknecht 97.8/100 98% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, stormbringers_runed_citrine_proc, errant_manaforge_emission, tempered_potion
0:05.026Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, errant_manaforge_emission, tempered_potion
0:05.026Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, errant_manaforge_emission, tempered_potion
0:05.026Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:06.032Ishadow_blades
[cds]
Messerknecht 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:06.032Ksecret_technique
[finish]
Fluffy_Pillow 77.5/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:07.038Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(3), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:08.043Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(4), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:09.048Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(4), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:10.053Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(4), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:11.056Mcoup_de_grace
[finish]
Fluffy_Pillow 85.9/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:12.263Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:13.267Neviscerate
[finish]
Fluffy_Pillow 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.271Hsymbols_of_death
[cds]
Messerknecht 92.9/100 93% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques, flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:14.271Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:15.275Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.279Fcold_blood
[cds]
Messerknecht 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(11), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.279Ksecret_technique
[finish]
Fluffy_Pillow 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(11), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.283Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(11), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.290Neviscerate
[finish]
Fluffy_Pillow 82.7/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(11), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:19.294Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.299Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:21.303Mcoup_de_grace
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(11), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.508Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(15), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.508Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(15), premeditation, shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.513Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), premeditation, shadow_techniques(7), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:24.519Neviscerate
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(9), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:25.525Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.530Hsymbols_of_death
[cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:26.530Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:27.535Ksecret_technique
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery, tempered_potion
0:28.540Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, tempered_potion
0:29.544Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
5.0/7 71% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, tempered_potion
0:30.548Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery, tempered_potion
0:31.550Ebackstab
[build]
Fluffy_Pillow 82.3/100 82% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:32.555Lrupture
[finish]
Fluffy_Pillow 56.4/100 56% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques, deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:33.557Ebackstab
[build]
Fluffy_Pillow 80.5/100 80% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques, deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:34.562Ebackstab
[build]
Fluffy_Pillow 70.6/100 71% energy
2.0/7 29% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(6), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:35.566Mcoup_de_grace
[finish]
Fluffy_Pillow 44.7/100 45% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:36.771Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:37.775Ebackstab
[build]
Fluffy_Pillow 90.1/100 90% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
0:38.779Neviscerate
[finish]
Fluffy_Pillow 72.2/100 72% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(11), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
0:39.784Ebackstab
[build]
Fluffy_Pillow 94.3/100 94% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
0:40.788Hsymbols_of_death
[cds]
Messerknecht 73.8/100 74% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:40.788Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:40.788Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:41.794Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:42.799Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
0:43.802Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:44.807Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:45.810Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:46.813Neviscerate
[finish]
Fluffy_Pillow 58.4/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:47.818Dshadowstrike
[build]
Fluffy_Pillow 69.2/100 69% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:48.821Neviscerate
[finish]
Fluffy_Pillow 42.9/100 43% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
0:49.825Ebackstab
[build]
Fluffy_Pillow 53.7/100 54% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
0:50.831Ebackstab
[build]
Fluffy_Pillow 40.5/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:53.229Neviscerate
[finish]
Fluffy_Pillow 42.3/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:54.234Ebackstab
[build]
Fluffy_Pillow 53.1/100 53% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:55.655Neviscerate
[finish]
Fluffy_Pillow 36.4/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:56.660Hsymbols_of_death
[cds]
Messerknecht 50.2/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:56.660Qshadow_dance
[stealth_cds]
Messerknecht 90.2/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:56.660Dshadowstrike
[build]
Fluffy_Pillow 90.2/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:57.662Neviscerate
[finish]
Fluffy_Pillow 63.9/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:58.667Dshadowstrike
[build]
Fluffy_Pillow 97.7/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
0:59.672Ksecret_technique
[finish]
Fluffy_Pillow 79.5/100 80% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form, shadow_techniques(8), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:00.677Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:01.882Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(3), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:02.887Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:03.891Dshadowstrike
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
1:04.894Lrupture
[finish]
Fluffy_Pillow 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:05.897Ebackstab
[build]
Fluffy_Pillow 90.1/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
1:06.901Ebackstab
[build]
Fluffy_Pillow 60.9/100 61% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_mastery
1:07.906Neviscerate
[finish]
Fluffy_Pillow 40.0/100 40% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:08.909Ebackstab
[build]
Fluffy_Pillow 46.4/100 46% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
1:11.222Ebackstab
[build]
Fluffy_Pillow 45.2/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:13.408Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:14.413Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:16.969Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:19.596Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:22.064Neviscerate
[finish]
Fluffy_Pillow 35.3/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:23.068Ebackstab
[build]
Fluffy_Pillow 51.5/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:25.256Ebackstab
[build]
Fluffy_Pillow 42.0/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:27.854Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
1:30.065Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 30.8/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
1:30.555Lrupture
[finish]
Fluffy_Pillow 40.5/100 41% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(3), stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
1:31.559Ebackstab
[build]
Fluffy_Pillow 66.1/100 66% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(4), stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
1:32.563Jflagellation
[cds]
Fluffy_Pillow 37.6/100 38% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, seabed_leviathans_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.566Hsymbols_of_death
[cds]
Messerknecht 53.0/100 53% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, flagellation_buff, seabed_leviathans_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.566Qshadow_dance
[stealth_cds]
Messerknecht 93.0/100 93% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, seabed_leviathans_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.566Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 93.0/100 93% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, seabed_leviathans_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
1:33.566Ksecret_technique
[finish]
Fluffy_Pillow 93.0/100 93% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:34.570Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:35.572Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(3), the_rotten, flagellation_buff(9), bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.777Ishadow_blades
[cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.777Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(5), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:37.783Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_buff(24), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:38.786Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:39.790Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:40.794Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:41.800Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques, flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:42.807Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:43.812Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:44.818Hsymbols_of_death
[cds]
Messerknecht 90.8/100 91% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:45.027Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:45.027Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:46.031Fcold_blood
[cds]
Messerknecht 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:46.031Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:47.036Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:48.041Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:49.046Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:50.050Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:51.054Mcoup_de_grace
[finish]
Fluffy_Pillow 60.2/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:52.258Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:53.264Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:54.269Neviscerate
[finish]
Fluffy_Pillow 79.4/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:55.275Ebackstab
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:56.281Ebackstab
[build]
Fluffy_Pillow 73.3/100 73% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:57.285Neviscerate
[finish]
Fluffy_Pillow 52.7/100 53% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:58.291Ebackstab
[build]
Fluffy_Pillow 72.1/100 72% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:59.294Neviscerate
[finish]
Fluffy_Pillow 43.5/100 43% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
2:00.299Ebackstab
[build]
Fluffy_Pillow 53.9/100 54% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
2:02.718Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:05.532Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:07.380Lrupture
[finish]
Fluffy_Pillow 26.3/100 26% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, flask_of_alchemical_chaos_haste
2:08.385Rvanish
[stealth_cds]
Messerknecht 42.7/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, flask_of_alchemical_chaos_haste
2:08.385Ebackstab
[build]
Fluffy_Pillow 42.7/100 43% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, premeditation, shadow_techniques, flask_of_alchemical_chaos_haste
2:09.882Hsymbols_of_death
[cds]
Messerknecht 19.7/100 20% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
2:10.027Qshadow_dance
[stealth_cds]
Messerknecht 61.3/100 61% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:10.027Ksecret_technique
[finish]
Fluffy_Pillow 61.3/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:11.032Dshadowstrike
[build]
Fluffy_Pillow 92.1/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:12.038Neviscerate
[finish]
Fluffy_Pillow 65.9/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(2), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:13.042Dshadowstrike
[build]
Fluffy_Pillow 99.7/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(4), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:14.046Mcoup_de_grace
[finish]
Fluffy_Pillow 73.5/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(6), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:15.250Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(7), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:16.254Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(8), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:17.258Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:18.265Neviscerate
[finish]
Fluffy_Pillow 50.4/100 50% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:19.268Ebackstab
[build]
Fluffy_Pillow 64.2/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:20.601Ebackstab
[build]
Fluffy_Pillow 46.5/100 47% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:22.573Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
2:23.579Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:26.891Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:29.871Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:31.721Lrupture
[finish]
Fluffy_Pillow 25.0/100 25% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:32.727Ebackstab
[build]
Fluffy_Pillow 49.8/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:35.288Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:37.611Ksecret_technique
[finish]
Fluffy_Pillow 30.3/100 30% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:38.616Ebackstab
[build]
Fluffy_Pillow 45.1/100 45% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(4), flawless_form(3), shadow_techniques(2), bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
2:41.507Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:44.340Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), bolstering_shadows, seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:46.699Mcoup_de_grace
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), seabed_leviathans_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
2:47.902Ebackstab
[build]
Fluffy_Pillow 79.2/100 79% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:48.906Ebackstab
[build]
Fluffy_Pillow 51.2/100 51% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:50.692Neviscerate
[finish]
Fluffy_Pillow 40.4/100 40% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:51.697Ebackstab
[build]
Fluffy_Pillow 47.4/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:54.260Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:57.280Ebackstab
[build]
Fluffy_Pillow 45.8/100 46% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:59.726Neviscerate
[finish]
Fluffy_Pillow 38.9/100 39% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:00.730Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 54.8/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:00.730Ebackstab
[build]
Fluffy_Pillow 54.8/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(3), deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:02.550Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, cryptic_instructions, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:03.554Jflagellation
[cds]
Fluffy_Pillow 12.4/100 12% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, deeper_daggers, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:04.559Hsymbols_of_death
[cds]
Messerknecht 27.8/100 28% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:04.559Qshadow_dance
[stealth_cds]
Messerknecht 67.8/100 68% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:04.559Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 67.8/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:04.559Neviscerate
[finish]
Fluffy_Pillow 67.8/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:05.563Dshadowstrike
[build]
Fluffy_Pillow 97.2/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:06.568Ishadow_blades
[cds]
Messerknecht 63.6/100 64% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, shadow_techniques(3), the_rotten, flagellation_buff(10), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:06.777Ksecret_technique
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, shadow_techniques(3), the_rotten, flagellation_buff(10), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:07.781Dshadowstrike
[build]
Fluffy_Pillow 97.4/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(3), the_rotten, flagellation_buff(20), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:08.785Neviscerate
[finish]
Fluffy_Pillow 71.8/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:09.789Dshadowstrike
[build]
Fluffy_Pillow 91.2/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(7), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:10.793Neviscerate
[finish]
Fluffy_Pillow 65.6/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(9), flagellation_buff(27), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:11.798Neviscerate
[finish]
Fluffy_Pillow 85.0/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:12.804Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:13.809Lrupture
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:14.814Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:15.818Hsymbols_of_death
[cds]
Messerknecht 79.4/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(10), flagellation_persist(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:15.818Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(10), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:15.818Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(10), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:17.021Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:18.025Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:19.030Fcold_blood
[cds]
Messerknecht 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:19.030Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:20.034Neviscerate
[finish]
Fluffy_Pillow 98.8/100 99% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:21.039Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:22.044Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:23.049Neviscerate
[finish]
Fluffy_Pillow 85.8/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
3:24.053Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
3:25.058Ebackstab
[build]
Fluffy_Pillow 71.4/100 71% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:26.062Hsymbols_of_death
[cds]
Messerknecht 50.8/100 51% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:26.062Neviscerate
[finish]
Fluffy_Pillow 90.8/100 91% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(8), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:27.069Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:27.069Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:28.074Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(4), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:29.078Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:30.082Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:31.086Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:32.090Ksecret_technique
[finish]
Fluffy_Pillow 68.2/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:33.094Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:34.099Mcoup_de_grace
[finish]
Fluffy_Pillow 67.0/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:35.303Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:36.309Lrupture
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:37.314Ebackstab
[build]
Fluffy_Pillow 92.8/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:38.321Ebackstab
[build]
Fluffy_Pillow 80.3/100 80% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:39.325Neviscerate
[finish]
Fluffy_Pillow 59.7/100 60% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
3:40.330Ebackstab
[build]
Fluffy_Pillow 79.1/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
3:41.334Neviscerate
[finish]
Fluffy_Pillow 58.5/100 58% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:42.338Ebackstab
[build]
Fluffy_Pillow 80.9/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_haste
3:43.341Neviscerate
[finish]
Fluffy_Pillow 52.3/100 52% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_haste
3:44.345Ebackstab
[build]
Fluffy_Pillow 63.7/100 64% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_haste
3:45.544Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
1.0/7 14% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:48.688Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:50.081Hsymbols_of_death
[cds]
Messerknecht 20.8/100 21% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
3:50.081Qshadow_dance
[stealth_cds]
Messerknecht 60.8/100 61% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:50.081Ksecret_technique
[finish]
Fluffy_Pillow 60.8/100 61% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:51.086Dshadowstrike
[build]
Fluffy_Pillow 90.2/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:52.091Neviscerate
[finish]
Fluffy_Pillow 56.7/100 57% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(3), the_rotten, bolstering_shadows, flask_of_alchemical_chaos_haste
3:53.098Dshadowstrike
[build]
Fluffy_Pillow 91.1/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(5), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:54.103Mcoup_de_grace
[finish]
Fluffy_Pillow 65.5/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:55.309Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:56.312Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:57.317Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:58.322Neviscerate
[finish]
Fluffy_Pillow 76.2/100 76% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(5), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
3:59.326Ebackstab
[build]
Fluffy_Pillow 95.6/100 96% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:00.331Neviscerate
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:01.335Ebackstab
[build]
Fluffy_Pillow 86.4/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:02.339Ebackstab
[build]
Fluffy_Pillow 65.8/100 66% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:03.344Ksecret_technique
[finish]
Fluffy_Pillow 37.2/100 37% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:04.348Ebackstab
[build]
Fluffy_Pillow 53.7/100 54% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:06.377Ebackstab
[build]
Fluffy_Pillow 40.7/100 41% energy
1.0/7 14% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:09.632Rvanish
[stealth_cds]
Messerknecht 41.7/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_haste
4:09.632Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
3.0/7 43% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), premeditation, shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_haste
4:11.354Lrupture
[finish]
Fluffy_Pillow 25.2/100 25% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flask_of_alchemical_chaos_haste
4:12.357Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), flask_of_alchemical_chaos_haste
4:14.700Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:17.085Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:18.290Ebackstab
[build]
Fluffy_Pillow 74.0/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:19.295Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:21.699Neviscerate
[finish]
Fluffy_Pillow 36.7/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:22.703Ebackstab
[build]
Fluffy_Pillow 47.1/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:25.245Ebackstab
[build]
Fluffy_Pillow 44.0/100 44% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:28.119Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:30.689Neviscerate
[finish]
Fluffy_Pillow 37.8/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:31.696Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 49.2/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:31.696Ebackstab
[build]
Fluffy_Pillow 49.2/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:33.808Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
4:34.813Jflagellation
[cds]
Fluffy_Pillow 12.6/100 13% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:35.815Hsymbols_of_death
[cds]
Messerknecht 28.0/100 28% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, flagellation_buff, deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:35.815Qshadow_dance
[stealth_cds]
Messerknecht 68.0/100 68% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:35.815Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.0/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_haste
4:35.815Ksecret_technique
[finish]
Fluffy_Pillow 68.0/100 68% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:36.820Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:37.825Ishadow_blades
[cds]
Messerknecht 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(3), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:37.825Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(3), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:39.031Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:40.036Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:41.040Neviscerate
[finish]
Fluffy_Pillow 93.2/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:42.044Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:43.048Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:44.053Ebackstab
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:45.057Lrupture
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(10), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:46.063Hsymbols_of_death
[cds]
Messerknecht 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:46.063Qshadow_dance
[stealth_cds]
Messerknecht 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:46.063Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:47.068Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), premeditation, shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:48.073Fcold_blood
[cds]
Messerknecht 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:48.073Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:49.077Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:50.080Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
4:51.084Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
4:52.087Dshadowstrike
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
4:53.091Mcoup_de_grace
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(10), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
4:54.295Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
4:55.298Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
4:56.304Neviscerate
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
4:57.308Ebackstab
[build]
Fluffy_Pillow 89.6/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
4:58.311Neviscerate
[finish]
Fluffy_Pillow 68.4/100 68% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
4:59.315Ebackstab
[build]
Fluffy_Pillow 74.4/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:00.318Ebackstab
[build]
Fluffy_Pillow 45.4/100 45% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:02.537Ebackstab
[build]
Fluffy_Pillow 41.7/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:04.863Hsymbols_of_death
[cds]
Messerknecht 31.3/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:05.027Qshadow_dance
[stealth_cds]
Messerknecht 73.1/100 73% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:05.027Ksecret_technique
[finish]
Fluffy_Pillow 73.1/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:06.031Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:07.037Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(4), the_rotten, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:08.042Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:09.047Neviscerate
[finish]
Fluffy_Pillow 82.0/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
5:10.052Dshadowstrike
[build]
Fluffy_Pillow 93.1/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
5:11.056Neviscerate
[finish]
Fluffy_Pillow 67.7/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
5:12.062Dshadowstrike
[build]
Fluffy_Pillow 87.4/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
5:13.066Gpotion
[cds]
Fluffy_Pillow 62.0/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste
5:13.066Lrupture
[finish]
Fluffy_Pillow 62.0/100 62% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:14.071Ebackstab
[build]
Fluffy_Pillow 83.9/100 84% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:15.075Ebackstab
[build]
Fluffy_Pillow 63.7/100 64% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:16.079Mcoup_de_grace
[finish]
Fluffy_Pillow 43.5/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:17.283Ebackstab
[build]
Fluffy_Pillow 82.7/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:18.287Ebackstab
[build]
Fluffy_Pillow 70.6/100 71% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
5:19.294Neviscerate
[finish]
Fluffy_Pillow 50.7/100 51% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:20.299Ebackstab
[build]
Fluffy_Pillow 66.7/100 67% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(5), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:21.304Neviscerate
[finish]
Fluffy_Pillow 38.8/100 39% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:22.309Ebackstab
[build]
Fluffy_Pillow 49.9/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:24.481Ebackstab
[build]
Fluffy_Pillow 44.0/100 44% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:27.279Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:29.158Ksecret_technique
[finish]
Fluffy_Pillow 32.1/100 32% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:30.162Hsymbols_of_death
[cds]
Messerknecht 53.2/100 53% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(3), bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:30.162Ebackstab
[build]
Fluffy_Pillow 93.2/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(3), the_rotten(2), poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:31.167Neviscerate
[finish]
Fluffy_Pillow 73.3/100 73% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:32.171Ebackstab
[build]
Fluffy_Pillow 85.3/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:33.174Qshadow_dance
[stealth_cds]
Messerknecht 65.4/100 65% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:33.174Mcoup_de_grace
[finish]
Fluffy_Pillow 65.4/100 65% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:34.377Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), premeditation, shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:35.382Neviscerate
[finish]
Fluffy_Pillow 66.8/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:36.387Dshadowstrike
[build]
Fluffy_Pillow 86.7/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:37.392Neviscerate
[finish]
Fluffy_Pillow 61.5/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:38.397Dshadowstrike
[build]
Fluffy_Pillow 81.4/100 81% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:39.401Neviscerate
[finish]
Fluffy_Pillow 56.2/100 56% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:40.404Dshadowstrike
[build]
Fluffy_Pillow 68.0/100 68% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:41.409Neviscerate
[finish]
Fluffy_Pillow 50.8/100 51% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(4), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion
5:42.414Ebackstab
[build]
Fluffy_Pillow 62.7/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste, tempered_potion

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste8.16%2.79%1843
Versatility25.21%22.21%17321
Attack Power6162857457938
Mastery64.97%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Messerknecht"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385,crafted_stats=32/49
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460,crafted_stats=40/32

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Simulation & Raid Information

Iterations: 1333
Threads: 12
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.2 )

Performance:

Total Events Processed: 36735730
Max Event Queue: 914
Sim Seconds: 398892
CPU Seconds: 96.8125
Physical Seconds: 10.0651
Speed Up: 4120

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Combo 1 Combo 1 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 1 Combo 1 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.41sec 0 299.24sec
Combo 1 Combo 1 auto_attack_mh 0 7326309 24483 70.03 20755 41761 349.3 349.3 17.3% 16.4% 0.0% 0.0% 1.00sec 9562423 299.24sec
Combo 1 Combo 1 auto_attack_oh 1 3695993 12351 69.95 10477 21118 348.9 348.9 17.2% 16.4% 0.0% 0.0% 1.00sec 4824069 299.24sec
Combo 1 Combo 1 backstab 53 4785011 15990 14.95 39449 102382 74.6 74.6 39.3% 0.0% 0.0% 0.0% 3.73sec 6265254 299.24sec
Combo 1 Combo 1 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.74sec 0 299.24sec
Combo 1 Combo 1 coup_de_grace 441776 11972414 40009 7.92 239397 474455 13.2 39.5 27.2% 0.0% 0.0% 0.0% 22.32sec 15588781 299.24sec
Combo 1 Combo 1 eviscerate_coup_de_grace_bonus 462244 5102207 17050 7.60 106266 212167 0.0 37.9 26.8% 0.0% 0.0% 0.0% 0.00sec 5102207 299.24sec
Combo 1 Combo 1 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.60sec 0 299.24sec
Combo 1 Combo 1 eviscerate 196819 34626784 115714 13.63 397137 815371 68.0 68.0 26.8% 0.0% 0.0% 0.0% 4.40sec 45045450 299.24sec
Combo 1 Combo 1 eviscerate_bonus 328082 14932279 49900 13.34 174900 357987 66.5 66.5 27.1% 0.0% 0.0% 0.0% 4.51sec 14932279 299.24sec
Combo 1 Combo 1 flagellation 384631 166076 555 0.74 37868 75494 3.7 3.7 18.4% 0.0% 0.0% 0.0% 91.39sec 166076 299.24sec
Combo 1 Combo 1 flagellation_damage 394757 3178925 10623 4.78 113248 225972 0.0 23.8 17.9% 0.0% 0.0% 0.0% 0.00sec 3178925 299.24sec
Combo 1 Combo 1 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 1 Combo 1 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 1 Combo 1 instant_poison 315585 1917700 6408 56.03 5841 11746 0.0 279.4 17.3% 0.0% 0.0% 0.0% 0.00sec 1917700 299.24sec
Combo 1 Combo 1 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.19sec 0 299.24sec
Combo 1 Combo 1 recuperator 426605 0 0 0.00 0 0 98.6 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.24sec
Combo 1 Combo 1 rupture ticks -1943 13126393 43755 32.94 62104 129341 9.5 164.7 26.2% 0.0% 0.0% 0.0% 31.39sec 13126393 299.24sec
Combo 1 Combo 1 rupture_replicating_shadows ticks -394031 2412556 8042 0.00 11423 23733 164.7 0.0 26.2% 0.0% 0.0% 0.0% 1.79sec 2412556 299.24sec
Combo 1 Combo 1 secret_technique 280719 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 18.97sec 0 299.24sec
Combo 1 Combo 1 secret_technique_player 280720 9597133 32071 3.20 312333 1002110 0.0 15.9 42.0% 0.0% 0.0% 0.0% 0.00sec 12512912 299.24sec
Combo 1 Combo 1 secret_technique_clones 282449 27752725 92743 6.37 454460 1439054 0.0 31.8 42.6% 0.0% 0.0% 0.0% 0.00sec 27752725 299.24sec
Combo 1 Combo 1 shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.91sec 0 299.24sec
Combo 1 Combo 1 shadow_blades_attack ticks -279043 15069772 50233 0.00 39407 0 382.4 0.0 0.0% 0.0% 0.0% 0.0% 1.21sec 15069772 299.24sec
Combo 1 Combo 1 shadow_dance 185313 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.17sec 0 299.24sec
Combo 1 Combo 1 shadowstrike 185438 18797216 62816 10.48 152000 495668 52.3 52.3 60.4% 0.0% 0.0% 0.0% 5.79sec 24516816 299.24sec
Combo 1 Combo 1 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 1 Combo 1 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.34sec 0 299.24sec
Combo 1 Combo 1 unseen_blade 441144 13483150 45057 11.58 198674 400155 57.8 57.8 17.3% 0.0% 0.0% 0.0% 5.13sec 17620476 299.24sec
Combo 1 Combo 1 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.41sec 0 299.24sec
Combo 2 Combo 2 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 2 Combo 2 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.48sec 0 299.24sec
Combo 2 Combo 2 auto_attack_mh 0 7321592 24467 70.02 20683 41714 349.2 349.2 17.4% 16.3% 0.0% 0.0% 1.00sec 9556930 299.24sec
Combo 2 Combo 2 auto_attack_oh 1 3691656 12337 69.97 10440 21092 348.9 348.9 17.3% 16.3% 0.0% 0.0% 1.00sec 4818659 299.24sec
Combo 2 Combo 2 backstab 53 4772073 15947 14.98 39344 102082 74.7 74.7 39.1% 0.0% 0.0% 0.0% 3.70sec 6248824 299.24sec
Combo 2 Combo 2 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.76sec 0 299.24sec
Combo 2 Combo 2 coup_de_grace 441776 11934104 39881 7.92 237724 474335 13.2 39.5 27.2% 0.0% 0.0% 0.0% 22.50sec 15539669 299.24sec
Combo 2 Combo 2 eviscerate_coup_de_grace_bonus 462244 5096209 17030 7.58 105619 212866 0.0 37.8 27.1% 0.0% 0.0% 0.0% 0.00sec 5096209 299.24sec
Combo 2 Combo 2 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.51sec 0 299.24sec
Combo 2 Combo 2 eviscerate 196819 34537552 115416 13.64 395610 811177 68.0 68.0 27.0% 0.0% 0.0% 0.0% 4.39sec 44929509 299.24sec
Combo 2 Combo 2 eviscerate_bonus 328082 14912354 49834 13.36 173590 358805 66.6 66.6 27.1% 0.0% 0.0% 0.0% 4.49sec 14912354 299.24sec
Combo 2 Combo 2 flagellation 384631 164238 549 0.74 37653 75368 3.7 3.7 17.6% 0.0% 0.0% 0.0% 91.39sec 164238 299.24sec
Combo 2 Combo 2 flagellation_damage 394757 3149465 10525 4.77 112965 223604 0.0 23.8 17.5% 0.0% 0.0% 0.0% 0.00sec 3149465 299.24sec
Combo 2 Combo 2 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 2 Combo 2 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 2 Combo 2 instant_poison 315585 1917627 6408 56.14 5821 11726 0.0 280.0 17.4% 0.0% 0.0% 0.0% 0.00sec 1917627 299.24sec
Combo 2 Combo 2 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.14sec 0 299.24sec
Combo 2 Combo 2 recuperator 426605 0 0 0.00 0 0 98.6 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.24sec
Combo 2 Combo 2 rupture ticks -1943 13088293 43628 32.95 61820 128580 9.5 164.8 26.4% 0.0% 0.0% 0.0% 31.32sec 13088293 299.24sec
Combo 2 Combo 2 rupture_replicating_shadows ticks -394031 2401125 8004 0.00 11359 23636 164.8 0.0 26.2% 0.0% 0.0% 0.0% 1.78sec 2401125 299.24sec
Combo 2 Combo 2 secret_technique 280719 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 19.09sec 0 299.24sec
Combo 2 Combo 2 secret_technique_player 280720 9484414 31695 3.20 309900 995456 0.0 15.9 41.6% 0.0% 0.0% 0.0% 0.00sec 12366001 299.24sec
Combo 2 Combo 2 secret_technique_clones 282449 27532071 92006 6.37 449747 1424570 0.0 31.8 42.8% 0.0% 0.0% 0.0% 0.00sec 27532071 299.24sec
Combo 2 Combo 2 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.90sec 0 299.24sec
Combo 2 Combo 2 shadow_blades_attack ticks -279043 15050206 50167 0.00 39328 0 382.6 0.0 0.0% 0.0% 0.0% 0.0% 1.21sec 15050206 299.24sec
Combo 2 Combo 2 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.20sec 0 299.24sec
Combo 2 Combo 2 shadowstrike 185438 18770604 62727 10.47 151511 494076 52.2 52.2 60.8% 0.0% 0.0% 0.0% 5.84sec 24482987 299.24sec
Combo 2 Combo 2 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 2 Combo 2 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.33sec 0 299.24sec
Combo 2 Combo 2 unseen_blade 441144 13447773 44939 11.55 198317 398590 57.6 57.6 17.5% 0.0% 0.0% 0.0% 5.21sec 17575858 299.24sec
Combo 2 Combo 2 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.48sec 0 299.24sec
Combo 3 Combo 3 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 3 Combo 3 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.47sec 0 299.24sec
Combo 3 Combo 3 auto_attack_mh 0 7310175 24429 70.00 20696 41657 349.1 349.1 17.3% 16.4% 0.0% 0.0% 1.00sec 9542444 299.24sec
Combo 3 Combo 3 auto_attack_oh 1 3681961 12304 69.85 10450 21072 348.4 348.4 17.3% 16.4% 0.0% 0.0% 1.00sec 4806298 299.24sec
Combo 3 Combo 3 backstab 53 4771580 15945 14.98 39328 102058 74.7 74.7 39.1% 0.0% 0.0% 0.0% 3.71sec 6248377 299.24sec
Combo 3 Combo 3 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.86sec 0 299.24sec
Combo 3 Combo 3 coup_de_grace 441776 12004140 40115 7.93 238505 475255 13.2 39.6 27.5% 0.0% 0.0% 0.0% 22.47sec 15630559 299.24sec
Combo 3 Combo 3 eviscerate_coup_de_grace_bonus 462244 5118820 17106 7.60 105799 214318 0.0 37.9 27.1% 0.0% 0.0% 0.0% 0.00sec 5118820 299.24sec
Combo 3 Combo 3 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.76sec 0 299.24sec
Combo 3 Combo 3 eviscerate 196819 34452405 115132 13.62 395597 810474 67.9 67.9 26.9% 0.0% 0.0% 0.0% 4.40sec 44819242 299.24sec
Combo 3 Combo 3 eviscerate_bonus 328082 14838912 49588 13.33 174097 356481 66.5 66.5 27.0% 0.0% 0.0% 0.0% 4.49sec 14838912 299.24sec
Combo 3 Combo 3 flagellation 384631 164745 551 0.74 37734 75587 3.7 3.7 17.5% 0.0% 0.0% 0.0% 91.21sec 164745 299.24sec
Combo 3 Combo 3 flagellation_damage 394757 3158005 10553 4.78 113008 224495 0.0 23.8 17.6% 0.0% 0.0% 0.0% 0.00sec 3158005 299.24sec
Combo 3 Combo 3 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 3 Combo 3 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 3 Combo 3 instant_poison 315585 1911799 6389 56.02 5821 11734 0.0 279.4 17.3% 0.0% 0.0% 0.0% 0.00sec 1911799 299.24sec
Combo 3 Combo 3 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.22sec 0 299.24sec
Combo 3 Combo 3 recuperator 426605 0 0 0.00 0 0 98.6 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.24sec
Combo 3 Combo 3 rupture ticks -1943 13077682 43592 32.97 61848 128613 9.5 164.9 26.2% 0.0% 0.0% 0.0% 31.21sec 13077682 299.24sec
Combo 3 Combo 3 rupture_replicating_shadows ticks -394031 2407758 8026 0.00 11359 23665 164.9 0.0 26.4% 0.0% 0.0% 0.0% 1.78sec 2407758 299.24sec
Combo 3 Combo 3 secret_technique 280719 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 19.10sec 0 299.24sec
Combo 3 Combo 3 secret_technique_player 280720 9505283 31764 3.19 309652 994724 0.0 15.9 41.9% 0.0% 0.0% 0.0% 0.00sec 12394315 299.24sec
Combo 3 Combo 3 secret_technique_clones 282449 27526821 91988 6.37 450375 1425250 0.0 31.8 42.7% 0.0% 0.0% 0.0% 0.00sec 27526821 299.24sec
Combo 3 Combo 3 shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.73sec 0 299.24sec
Combo 3 Combo 3 shadow_blades_attack ticks -279043 15070317 50234 0.00 39362 0 382.9 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 15070317 299.24sec
Combo 3 Combo 3 shadow_dance 185313 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.20sec 0 299.24sec
Combo 3 Combo 3 shadowstrike 185438 18744768 62641 10.47 151571 494517 52.2 52.2 60.5% 0.0% 0.0% 0.0% 5.80sec 24450122 299.24sec
Combo 3 Combo 3 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 3 Combo 3 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.34sec 0 299.24sec
Combo 3 Combo 3 unseen_blade 441144 13435992 44900 11.57 198313 399054 57.7 57.7 17.2% 0.0% 0.0% 0.0% 5.19sec 17559819 299.24sec
Combo 3 Combo 3 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.47sec 0 299.24sec
Combo 4 Combo 4 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 4 Combo 4 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.43sec 0 299.24sec
Combo 4 Combo 4 auto_attack_mh 0 7325605 24480 69.98 20750 41788 349.0 349.0 17.3% 16.4% 0.0% 0.0% 1.00sec 9562178 299.24sec
Combo 4 Combo 4 auto_attack_oh 1 3694139 12345 69.92 10483 21077 348.7 348.7 17.2% 16.3% 0.0% 0.0% 1.00sec 4822073 299.24sec
Combo 4 Combo 4 backstab 53 4789876 16007 14.98 39442 102344 74.7 74.7 39.2% 0.0% 0.0% 0.0% 3.70sec 6271727 299.24sec
Combo 4 Combo 4 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.77sec 0 299.24sec
Combo 4 Combo 4 coup_de_grace 441776 12079995 40368 7.93 239773 480644 13.2 39.6 27.3% 0.0% 0.0% 0.0% 22.52sec 15729281 299.24sec
Combo 4 Combo 4 eviscerate_coup_de_grace_bonus 462244 5158840 17240 7.60 106658 214819 0.0 37.9 27.2% 0.0% 0.0% 0.0% 0.00sec 5158840 299.24sec
Combo 4 Combo 4 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.18sec 0 299.24sec
Combo 4 Combo 4 eviscerate 196819 34687932 115919 13.63 397572 813783 68.0 68.0 27.1% 0.0% 0.0% 0.0% 4.40sec 45126195 299.24sec
Combo 4 Combo 4 eviscerate_bonus 328082 14925374 49877 13.34 174686 359880 66.5 66.5 26.9% 0.0% 0.0% 0.0% 4.50sec 14925374 299.24sec
Combo 4 Combo 4 flagellation 384631 165033 552 0.74 37811 75565 3.7 3.7 17.7% 0.0% 0.0% 0.0% 91.41sec 165033 299.24sec
Combo 4 Combo 4 flagellation_damage 394757 3163266 10571 4.77 113214 223996 0.0 23.8 17.9% 0.0% 0.0% 0.0% 0.00sec 3163266 299.24sec
Combo 4 Combo 4 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 4 Combo 4 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 4 Combo 4 instant_poison 315585 1921527 6421 56.10 5840 11752 0.0 279.8 17.4% 0.0% 0.0% 0.0% 0.00sec 1921527 299.24sec
Combo 4 Combo 4 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.18sec 0 299.24sec
Combo 4 Combo 4 recuperator 426605 0 0 0.00 0 0 98.6 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.24sec
Combo 4 Combo 4 rupture ticks -1943 13148328 43828 32.96 62285 128789 9.5 164.8 26.3% 0.0% 0.0% 0.0% 31.18sec 13148328 299.24sec
Combo 4 Combo 4 rupture_replicating_shadows ticks -394031 2417519 8058 0.00 11434 23772 164.8 0.0 26.2% 0.0% 0.0% 0.0% 1.78sec 2417519 299.24sec
Combo 4 Combo 4 secret_technique 280719 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 19.08sec 0 299.24sec
Combo 4 Combo 4 secret_technique_player 280720 9536392 31868 3.20 312290 994796 0.0 15.9 41.9% 0.0% 0.0% 0.0% 0.00sec 12434883 299.24sec
Combo 4 Combo 4 secret_technique_clones 282449 27613021 92276 6.37 454268 1425683 0.0 31.8 42.7% 0.0% 0.0% 0.0% 0.00sec 27613021 299.24sec
Combo 4 Combo 4 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.91sec 0 299.24sec
Combo 4 Combo 4 shadow_blades_attack ticks -279043 15070895 50236 0.00 39414 0 382.4 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 15070895 299.24sec
Combo 4 Combo 4 shadow_dance 185313 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.21sec 0 299.24sec
Combo 4 Combo 4 shadowstrike 185438 18788538 62787 10.47 152216 495639 52.2 52.2 60.5% 0.0% 0.0% 0.0% 5.82sec 24507618 299.24sec
Combo 4 Combo 4 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 4 Combo 4 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.32sec 0 299.24sec
Combo 4 Combo 4 unseen_blade 441144 13458967 44977 11.57 199019 399365 57.7 57.7 17.1% 0.0% 0.0% 0.0% 5.22sec 17590622 299.24sec
Combo 4 Combo 4 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.43sec 0 299.24sec
Combo 5 Combo 5 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 5 Combo 5 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.57sec 0 299.24sec
Combo 5 Combo 5 auto_attack_mh 0 7335578 24514 70.08 20750 41781 349.5 349.5 17.3% 16.3% 0.0% 0.0% 1.00sec 9574902 299.24sec
Combo 5 Combo 5 auto_attack_oh 1 3694588 12346 69.93 10480 21076 348.8 348.8 17.2% 16.3% 0.0% 0.0% 1.00sec 4822353 299.24sec
Combo 5 Combo 5 backstab 53 4770959 15943 14.95 39461 102197 74.6 74.6 39.1% 0.0% 0.0% 0.0% 3.71sec 6246432 299.24sec
Combo 5 Combo 5 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.64sec 0 299.24sec
Combo 5 Combo 5 coup_de_grace 441776 12048932 40265 7.90 240716 478972 13.1 39.4 27.4% 0.0% 0.0% 0.0% 22.66sec 15689019 299.24sec
Combo 5 Combo 5 eviscerate_coup_de_grace_bonus 462244 5130197 17144 7.57 106973 214521 0.0 37.7 27.0% 0.0% 0.0% 0.0% 0.00sec 5130197 299.24sec
Combo 5 Combo 5 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.74sec 0 299.24sec
Combo 5 Combo 5 eviscerate 196819 34612244 115666 13.64 397267 814051 68.0 68.0 26.8% 0.0% 0.0% 0.0% 4.38sec 45026633 299.24sec
Combo 5 Combo 5 eviscerate_bonus 328082 14900250 49793 13.36 174805 357452 66.6 66.6 26.8% 0.0% 0.0% 0.0% 4.47sec 14900250 299.24sec
Combo 5 Combo 5 flagellation 384631 164130 548 0.74 37749 75594 3.7 3.7 17.4% 0.0% 0.0% 0.0% 91.26sec 164130 299.24sec
Combo 5 Combo 5 flagellation_damage 394757 3171174 10597 4.78 113263 224019 0.0 23.8 17.8% 0.0% 0.0% 0.0% 0.00sec 3171174 299.24sec
Combo 5 Combo 5 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 5 Combo 5 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 5 Combo 5 instant_poison 315585 1917555 6408 56.05 5840 11750 0.0 279.5 17.3% 0.0% 0.0% 0.0% 0.00sec 1917555 299.24sec
Combo 5 Combo 5 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.16sec 0 299.24sec
Combo 5 Combo 5 recuperator 426605 0 0 0.00 0 0 98.6 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.24sec
Combo 5 Combo 5 rupture ticks -1943 13128087 43760 32.96 62136 129429 9.5 164.8 26.0% 0.0% 0.0% 0.0% 31.25sec 13128087 299.24sec
Combo 5 Combo 5 rupture_replicating_shadows ticks -394031 2412120 8040 0.00 11426 23729 164.8 0.0 26.1% 0.0% 0.0% 0.0% 1.78sec 2412120 299.24sec
Combo 5 Combo 5 secret_technique 280719 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 18.99sec 0 299.24sec
Combo 5 Combo 5 secret_technique_player 280720 9554836 31930 3.19 312331 997405 0.0 15.9 42.0% 0.0% 0.0% 0.0% 0.00sec 12459040 299.24sec
Combo 5 Combo 5 secret_technique_clones 282449 27622614 92308 6.37 453826 1435734 0.0 31.8 42.4% 0.0% 0.0% 0.0% 0.00sec 27622614 299.24sec
Combo 5 Combo 5 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.83sec 0 299.24sec
Combo 5 Combo 5 shadow_blades_attack ticks -279043 15089912 50300 0.00 39415 0 382.8 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 15089912 299.24sec
Combo 5 Combo 5 shadow_dance 185313 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.22sec 0 299.24sec
Combo 5 Combo 5 shadowstrike 185438 18798282 62819 10.48 152158 495514 52.3 52.3 60.5% 0.0% 0.0% 0.0% 5.82sec 24521204 299.24sec
Combo 5 Combo 5 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 5 Combo 5 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.34sec 0 299.24sec
Combo 5 Combo 5 unseen_blade 441144 13457471 44972 11.55 198952 399673 57.6 57.6 17.3% 0.0% 0.0% 0.0% 5.22sec 17587691 299.24sec
Combo 5 Combo 5 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.57sec 0 299.24sec
Combo 6 Combo 6 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 6 Combo 6 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.29sec 0 299.24sec
Combo 6 Combo 6 auto_attack_mh 0 7310785 24431 70.09 20687 41647 349.6 349.6 17.3% 16.4% 0.0% 0.0% 1.00sec 9543952 299.24sec
Combo 6 Combo 6 auto_attack_oh 1 3690188 12332 69.93 10441 21076 348.8 348.8 17.3% 16.3% 0.0% 0.0% 1.00sec 4817324 299.24sec
Combo 6 Combo 6 backstab 53 4775498 15959 14.98 39318 102109 74.7 74.7 39.2% 0.0% 0.0% 0.0% 3.73sec 6253377 299.24sec
Combo 6 Combo 6 cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.62sec 0 299.24sec
Combo 6 Combo 6 coup_de_grace 441776 11991335 40072 7.95 237862 477784 13.2 39.6 27.0% 0.0% 0.0% 0.0% 22.41sec 15614868 299.24sec
Combo 6 Combo 6 eviscerate_coup_de_grace_bonus 462244 5129709 17142 7.60 106025 213007 0.0 37.9 27.4% 0.0% 0.0% 0.0% 0.00sec 5129709 299.24sec
Combo 6 Combo 6 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.43sec 0 299.24sec
Combo 6 Combo 6 eviscerate 196819 34495686 115276 13.61 397045 809140 67.9 67.9 27.0% 0.0% 0.0% 0.0% 4.41sec 44875549 299.24sec
Combo 6 Combo 6 eviscerate_bonus 328082 14875867 49712 13.31 174684 356687 66.4 66.4 27.1% 0.0% 0.0% 0.0% 4.51sec 14875867 299.24sec
Combo 6 Combo 6 flagellation 384631 164306 549 0.74 37741 75202 3.7 3.7 17.4% 0.0% 0.0% 0.0% 91.27sec 164306 299.24sec
Combo 6 Combo 6 flagellation_damage 394757 3156135 10547 4.77 112724 225038 0.0 23.8 17.7% 0.0% 0.0% 0.0% 0.00sec 3156135 299.24sec
Combo 6 Combo 6 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 6 Combo 6 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 6 Combo 6 instant_poison 315585 1913564 6395 56.03 5822 11717 0.0 279.5 17.4% 0.0% 0.0% 0.0% 0.00sec 1913564 299.24sec
Combo 6 Combo 6 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.11sec 0 299.24sec
Combo 6 Combo 6 recuperator 426605 0 0 0.00 0 0 98.6 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.24sec
Combo 6 Combo 6 rupture ticks -1943 13125312 43751 32.97 61857 128965 9.5 164.9 26.5% 0.0% 0.0% 0.0% 31.36sec 13125312 299.24sec
Combo 6 Combo 6 rupture_replicating_shadows ticks -394031 2406159 8021 0.00 11387 23604 164.9 0.0 26.3% 0.0% 0.0% 0.0% 1.78sec 2406159 299.24sec
Combo 6 Combo 6 secret_technique 280719 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 19.06sec 0 299.24sec
Combo 6 Combo 6 secret_technique_player 280720 9497451 31738 3.19 310507 995985 0.0 15.9 41.7% 0.0% 0.0% 0.0% 0.00sec 12386687 299.24sec
Combo 6 Combo 6 secret_technique_clones 282449 27507073 91922 6.37 452704 1423854 0.0 31.8 42.6% 0.0% 0.0% 0.0% 0.00sec 27507073 299.24sec
Combo 6 Combo 6 shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.89sec 0 299.24sec
Combo 6 Combo 6 shadow_blades_attack ticks -279043 15050447 50168 0.00 39398 0 382.1 0.0 0.0% 0.0% 0.0% 0.0% 1.21sec 15050447 299.24sec
Combo 6 Combo 6 shadow_dance 185313 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.21sec 0 299.24sec
Combo 6 Combo 6 shadowstrike 185438 18741485 62630 10.47 151735 494220 52.2 52.2 60.5% 0.0% 0.0% 0.0% 5.77sec 24446781 299.24sec
Combo 6 Combo 6 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Combo 6 Combo 6 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.34sec 0 299.24sec
Combo 6 Combo 6 unseen_blade 441144 13494488 45095 11.61 198494 397048 57.9 57.9 17.4% 0.0% 0.0% 0.0% 5.18sec 17636582 299.24sec
Combo 6 Combo 6 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.29sec 0 299.24sec
Messerknecht Messerknecht augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Messerknecht Messerknecht auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.57sec 0 299.24sec
Messerknecht Messerknecht auto_attack_mh 0 14039006 46915 70.95 38419 77526 353.9 353.9 19.3% 16.4% 0.0% 0.0% 0.98sec 18314848 299.24sec
Messerknecht Messerknecht auto_attack_oh 1 6988111 23353 70.83 19142 38602 353.3 353.3 19.4% 16.4% 0.0% 0.0% 0.98sec 9116840 299.24sec
Messerknecht Messerknecht backstab 53 9075526 30328 15.10 72996 188684 75.3 75.3 41.1% 0.0% 0.0% 0.0% 3.67sec 11873774 299.24sec
Messerknecht Messerknecht cold_blood 382245 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.64sec 0 299.24sec
Messerknecht Messerknecht coup_de_grace 441776 26818318 89620 7.97 519364 1049575 13.3 39.7 29.3% 0.0% 0.0% 0.0% 22.18sec 34911642 299.24sec
Messerknecht Messerknecht eviscerate_coup_de_grace_bonus 462244 11473545 38342 7.68 231127 462023 0.0 38.3 29.6% 0.0% 0.0% 0.0% 0.00sec 11473545 299.24sec
Messerknecht Messerknecht cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.92sec 0 299.24sec
Messerknecht Messerknecht elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Messerknecht Messerknecht elemental_focusing_lens_onyx 461191 6028367 20145 4.48 269802 0 22.4 22.3 0.0% 0.0% 0.0% 0.0% 12.81sec 6028367 299.24sec
Messerknecht Messerknecht eviscerate 196819 76597332 255970 13.74 860895 1754323 68.5 68.5 28.8% 0.0% 0.0% 0.0% 4.37sec 99640259 299.24sec
Messerknecht Messerknecht eviscerate_bonus 328082 33053347 110456 13.48 378628 767375 67.2 67.2 29.1% 0.0% 0.0% 0.0% 4.45sec 33053347 299.24sec
Messerknecht Messerknecht flagellation 384631 309321 1034 0.74 69696 139815 3.7 3.7 19.5% 0.0% 0.0% 0.0% 91.29sec 309321 299.24sec
Messerknecht Messerknecht flagellation_damage 394757 6008016 20077 4.79 209409 423215 0.0 23.9 19.8% 0.0% 0.0% 0.0% 0.00sec 6008016 299.24sec
Messerknecht Messerknecht flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Messerknecht Messerknecht food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Messerknecht Messerknecht instant_poison 315585 3653014 12207 56.70 10803 21720 0.0 282.8 19.4% 0.0% 0.0% 0.0% 0.00sec 3653014 299.24sec
Messerknecht Messerknecht legendary_skippers_citrine 462962 0 0 0.00 0 0 25.5 0.0 0.0% 0.0% 0.0% 0.0% 11.41sec 0 299.24sec
Messerknecht Messerknecht mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 71.08sec 0 299.24sec
Messerknecht Messerknecht old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 71.35sec 0 299.24sec
Messerknecht Messerknecht potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.21sec 0 299.24sec
Messerknecht Messerknecht recuperator 426605 0 0 0.00 0 0 98.6 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 299.24sec
Messerknecht Messerknecht rupture ticks -1943 29593106 98644 33.41 135907 281326 9.5 167.0 28.4% 0.0% 0.0% 0.0% 31.32sec 29593106 299.24sec
Messerknecht Messerknecht rupture_replicating_shadows ticks -394031 5449352 18165 0.00 24979 51840 167.0 0.0 28.5% 0.0% 0.0% 0.0% 1.76sec 5449352 299.24sec
Messerknecht Messerknecht secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.94sec 0 299.24sec
Messerknecht Messerknecht secret_technique_player 280720 20843070 69653 3.21 685502 2126206 0.0 16.0 42.9% 0.0% 0.0% 0.0% 0.00sec 27165139 299.24sec
Messerknecht Messerknecht secret_technique_clones 282449 60545119 202327 6.39 996956 3034522 0.0 31.9 44.2% 0.0% 0.0% 0.0% 0.00sec 60545119 299.24sec
Messerknecht Messerknecht shadow_blades 121471 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.84sec 0 299.24sec
Messerknecht Messerknecht shadow_blades_attack ticks -279043 31399560 104665 0.00 81432 0 385.5 0.0 0.0% 0.0% 0.0% 0.0% 1.20sec 31399560 299.24sec
Messerknecht Messerknecht shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.19sec 0 299.24sec
Messerknecht Messerknecht shadowstrike 185438 35149453 117461 10.45 281182 916825 52.1 52.1 61.9% 0.0% 0.0% 0.0% 5.85sec 45828374 299.24sec
Messerknecht Messerknecht squall_sailors_citrine 462952 1103643 3688 0.46 400752 805007 2.3 2.3 19.0% 0.0% 0.0% 0.0% 69.31sec 1103643 299.24sec
Messerknecht Messerknecht stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.24sec
Messerknecht Messerknecht storm_sewers_citrine 462958 0 0 0.48 0 0 2.4 2.4 0.0% 0.0% 0.0% 0.0% 70.53sec 1631914 299.24sec
Messerknecht Messerknecht storm_sewers_citrine_damage 468422 258998 866 0.48 91498 184100 2.4 2.4 18.7% 0.0% 0.0% 0.0% 70.53sec 258998 299.24sec
Messerknecht Messerknecht suffocating_darkness ticks -449217 14193043 47310 21.46 132322 0 19.2 107.3 0.0% 0.0% 0.0% 0.0% 14.91sec 14193043 299.24sec
Messerknecht Messerknecht symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.33sec 0 299.24sec
Messerknecht Messerknecht thunderlords_crackling_citrine 462951 16631917 55580 5.55 502323 1006979 27.7 27.7 19.6% 0.0% 0.0% 0.0% 10.66sec 16631917 299.24sec
Messerknecht Messerknecht undersea_overseers_citrine 462953 1344278 4492 0.47 480991 966116 2.3 2.3 19.3% 0.0% 0.0% 0.0% 68.63sec 1344278 299.24sec
Messerknecht Messerknecht unseen_blade 441144 25502820 85224 11.64 367723 741605 58.0 58.0 19.2% 0.0% 0.0% 0.0% 5.14sec 33310528 299.24sec
Messerknecht Messerknecht vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.57sec 0 299.24sec
Messerknecht Messerknecht windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 71.16sec 0 299.24sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health4,950,880.90.00.00%0.0100.0%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Fazed8.849.235.3s5.2s30.3s89.56%89.58%49.2 (49.2)7.9

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 157.7s
  • trigger_min/max:1.0s / 25.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 168.5s
  • uptime_min/max:77.69% / 99.39%

Stack Uptimes

  • fazed_1:89.56%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.849.035.4s5.2s30.4s89.44%89.51%49.0 (49.0)7.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 172.3s
  • trigger_min/max:1.0s / 24.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 170.7s
  • uptime_min/max:79.26% / 98.75%

Stack Uptimes

  • fazed_1:89.44%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.948.835.2s5.2s30.2s89.37%89.46%48.8 (48.8)7.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 153.3s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.2s
  • uptime_min/max:80.80% / 98.29%

Stack Uptimes

  • fazed_1:89.37%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.948.935.3s5.2s30.2s89.36%89.44%48.9 (48.9)7.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 166.4s
  • trigger_min/max:1.0s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 159.6s
  • uptime_min/max:77.37% / 97.58%

Stack Uptimes

  • fazed_1:89.36%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.948.835.1s5.2s30.1s89.37%89.45%48.8 (48.8)7.9

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 154.5s
  • trigger_min/max:1.0s / 25.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 147.1s
  • uptime_min/max:79.00% / 97.97%

Stack Uptimes

  • fazed_1:89.37%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.948.735.2s5.2s30.1s89.17%89.27%48.7 (48.7)7.9

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 152.9s
  • trigger_min/max:1.0s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 149.9s
  • uptime_min/max:77.89% / 97.65%

Stack Uptimes

  • fazed_1:89.17%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.849.135.5s5.2s30.4s89.38%89.47%49.1 (49.1)7.9

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 186.6s
  • trigger_min/max:1.0s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 179.1s
  • uptime_min/max:80.63% / 98.51%

Stack Uptimes

  • fazed_1:89.38%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.678.466.1s3.6s61.2s94.75%94.77%78.4 (78.4)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 291.2s
  • trigger_min/max:1.0s / 43.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 358.6s
  • uptime_min/max:82.24% / 100.00%

Stack Uptimes

  • find_weakness_1:94.75%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.976.662.3s3.7s56.9s94.04%94.10%76.6 (76.6)4.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 281.9s
  • trigger_min/max:1.0s / 47.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 298.3s
  • uptime_min/max:81.20% / 100.00%

Stack Uptimes

  • find_weakness_1:94.04%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness5.076.461.5s3.7s56.3s93.96%94.03%76.4 (76.4)4.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 280.3s
  • trigger_min/max:1.0s / 49.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 329.7s
  • uptime_min/max:81.14% / 100.00%

Stack Uptimes

  • find_weakness_1:93.96%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness5.076.561.8s3.7s56.3s93.89%93.96%76.5 (76.5)4.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 278.1s
  • trigger_min/max:1.0s / 42.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 327.0s
  • uptime_min/max:81.66% / 100.00%

Stack Uptimes

  • find_weakness_1:93.89%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness5.076.562.0s3.7s56.4s93.96%94.01%76.5 (76.5)4.0

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 276.8s
  • trigger_min/max:1.0s / 45.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 274.6s
  • uptime_min/max:78.65% / 100.00%

Stack Uptimes

  • find_weakness_1:93.96%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness5.076.461.7s3.7s56.7s93.98%94.05%76.4 (76.4)4.0

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 276.7s
  • trigger_min/max:1.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 312.8s
  • uptime_min/max:80.83% / 100.00%

Stack Uptimes

  • find_weakness_1:93.98%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness5.076.561.7s3.7s56.4s93.81%93.88%76.5 (76.5)4.0

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 276.8s
  • trigger_min/max:1.0s / 49.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 281.3s
  • uptime_min/max:81.25% / 100.00%

Stack Uptimes

  • find_weakness_1:93.81%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation3.70.091.0s91.3s11.8s14.70%22.26%0.0 (0.0)3.6

Buff Details

  • buff initial source:Messerknecht
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 97.8s
  • trigger_min/max:90.0s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.91% / 16.89%

Stack Uptimes

  • flagellation_1:14.70%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.9s14.70%22.38%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.0s
  • trigger_min/max:90.0s / 98.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.94% / 16.94%

Stack Uptimes

  • flagellation_1:14.70%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.69%22.32%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.1s
  • trigger_min/max:90.0s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.94% / 16.88%

Stack Uptimes

  • flagellation_1:14.69%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.70%22.37%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.4s
  • trigger_min/max:90.0s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.93% / 16.95%

Stack Uptimes

  • flagellation_1:14.70%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.9s14.70%22.32%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 4
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.5s
  • trigger_min/max:90.0s / 98.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.94% / 16.91%

Stack Uptimes

  • flagellation_1:14.70%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.9s14.69%22.38%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 5
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.4s
  • trigger_min/max:90.0s / 98.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s
  • uptime_min/max:12.90% / 16.88%

Stack Uptimes

  • flagellation_1:14.69%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.1s91.3s11.8s14.70%22.36%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 6
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.2s
  • trigger_min/max:90.0s / 98.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.99% / 16.92%

Stack Uptimes

  • flagellation_1:14.70%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1321
Mean 299.24
Minimum 240.10
Maximum 359.93
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Fluffy_Pillow Damage Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1321
Mean 5225259.64
Minimum 4870818.37
Maximum 5569838.75
Spread ( max - min ) 699020.39
Range [ ( max - min ) / 2 * 100% ] 6.69%
Standard Deviation 133664.1643
5th Percentile 5002024.53
95th Percentile 5426540.11
( 95th Percentile - 5th Percentile ) 424515.58
Mean Distribution
Standard Deviation 3677.5923
95.00% Confidence Interval ( 5218051.69 - 5232467.59 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2514
0.1 Scale Factor Error with Delta=300 152515381
0.05 Scale Factor Error with Delta=300 610061524
0.01 Scale Factor Error with Delta=300 15251538093
HPS
Fluffy_Pillow Healing Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health017622343120
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.